KEGG   Burkholderia sp. KJ006: MYA_3217Help
Entry
MYA_3217          CDS       T02110                                 

Definition
(GenBank) Selenide,water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00450  Selenocompound metabolism
buk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MYA_3217
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:buk03016]
    MYA_3217
Enzymes [BR:buk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     MYA_3217
Transfer RNA biogenesis [BR:buk03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    MYA_3217
 Prokaryotic Type
    MYA_3217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AFJ87576
UniProt: I2DSF0
Position
2:complement(325738..326802)
Genome map
AA seq 354 aa AA seqDB search
MTEATLTPPAVPRLTSLSHGGGCGCKIAPGVLSELLKRATPPALFPDLLVGTETSDDAAV
YRLNDEQAIVATTDFFMPIVDDPFDFGRIAATNALSDVYAMGGKPILALALVGMPINVLP
HETIAAVLRGGEAVCAEAGIPVAGGHSIDSVEPIYGLAAIGVVHPSRVKRNAAARAGDVL
VLGKPLGVGVLSAALKKNQLDAAGYAQMVATTTKLNRPGAELAALPDVHALTDVTGFGLL
GHTLELARGAGLTARVHYASLPWLAGVEAFVADGVFTGASGRNWAAYGADVRLADNLPPV
AQALLTDPQTSGGLLVACAPEAVDDVLACFRADGFDRAAVIGEMVDGASRVEVA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagccaccctcactccgcccgccgttccgcgcctgacgagcctgtcgcacggc
ggcggctgcggctgcaagatcgcgccgggcgtgttgtccgagctgctgaagcgggccacg
ccgcccgcgttgtttcccgatctgctggtcggcaccgaaacctccgacgacgcggccgtc
taccgattgaacgacgagcaggcgatcgtcgcgaccaccgactttttcatgccgatcgtc
gacgatccgttcgacttcggccgcatcgccgcgaccaatgcgctgtccgacgtctacgcg
atgggcggcaagccgatcctcgcgctcgcgctggtcggcatgccgatcaacgtgctgccg
cacgagacgatcgcggccgtgctgcgcggcggcgaagccgtgtgcgcggaagcgggcatt
ccggtggcgggcggccattcgatcgattcggtcgagccgatctacgggctcgccgcgatc
ggcgtcgtgcatccgtcgcgcgtgaagcgcaacgcggctgcgcgcgcgggcgacgtgctc
gtgctcggcaagccgctcggcgtcggcgtgctgtccgccgcgctgaagaagaatcagctc
gacgccgccggctacgcgcagatggtcgcgacgaccaccaagctgaaccggccgggcgcc
gaactcgcggcattgccggacgtgcacgcgctgaccgacgtcaccggtttcggtttgctc
ggccacacgctcgagctggcgcgcggcgcggggctgaccgcgcgcgtgcattacgcgtcg
ctgccgtggctggcgggcgtcgaggcgttcgtcgccgacggcgtgttcaccggcgcgtcg
ggacgcaactgggccgcgtatggcgccgacgtgcggctcgccgacaacctgccgcccgtc
gcgcaggcgctgctcaccgatccgcagacgtcgggcgggctgctggtcgcgtgcgcgccg
gaagccgtcgacgacgtgctcgcgtgcttccgcgccgacggcttcgaccgtgcggccgtg
atcggcgagatggtggacggggcgtcgcgcgtcgaggtcgcgtga

DBGET integrated database retrieval system