KEGG   Burkholderia sp. KJ006: MYA_4071Help
Entry
MYA_4071          CDS       T02110                                 

Definition
(GenBank) hypothetical protein
  KO
K11905  type VI secretion system protein
Organism
buk  Burkholderia sp. KJ006
Brite
KEGG Orthology (KO) [BR:buk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:buk02044]
    MYA_4071
Secretion system [BR:buk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   MYA_4071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25
Motif
Other DBs
NCBI-ProteinID: AFJ88429
UniProt: I2DUV3
Position
2:complement(1231083..1231514)
Genome map
AA seq 143 aa AA seqDB search
MWTGPGLFERITRHFADGSAVDDFAAEVQVFLSVRDNIERILNSRRGSLAHLPDYGLDDL
SAIYRHLPSSAHKLQRAIEATLLAYEPRLKKVEIEIHPPEPGMLISFTMACHLHREGLVR
FGTNFMPDGKTRLRMLQAALDRY
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgtggacaggtcctgggttgttcgagcgaatcacccgacattttgcggacggttcggca
gtagacgacttcgccgcggaggttcaggtctttctttcggttcgcgacaatatcgagcgc
atcttgaacagccgacgcggatcgctcgctcatctcccggactacgggctggatgaccta
tcggcgatctatcggcatctgccgtcctccgcgcacaagctccagcgcgcgatcgaggcc
accctgctcgcctacgaaccgcggctcaagaaggtggaaatcgaaattcatccgcccgaa
ccaggcatgttgatcagcttcacgatggcttgtcatttgcatcgcgaaggcttggtccgc
ttcggcacgaatttcatgccggacggtaagacccgcctgcgcatgctccaggctgcactg
gatcggtactga

DBGET integrated database retrieval system