KEGG   Burkholderia sp. KJ006: MYA_4079Help
Entry
MYA_4079          CDS       T02110                                 

Definition
(GenBank) hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
buk  Burkholderia sp. KJ006
Brite
KEGG Orthology (KO) [BR:buk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:buk02044]
    MYA_4079
Secretion system [BR:buk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   MYA_4079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssG
Motif
Other DBs
NCBI-ProteinID: AFJ88437
UniProt: I2DUW1
Position
2:1247420..1248433
Genome map
AA seq 337 aa AA seqDB search
MLPALLDQAHRMNFYRFCALIELASPDAAPLGATDSPATDPVRFRSRGQLGFPAREIDAV
EYDADDPAKPVAVRTTFLGLYGVDARMPAYFVDEVAQNRDGAEPLAAFLDLFHHRIATQF
YRIWRKYRYPAGFRPDGFDTVSRGALSLVGLGFRSPETRAPDWGLPRDVGARALLSMLGL
AAQKTRTAEGLAGVLTHAIPDAAIDVEEFYPVWRTVNDFEPAALGEQCLLGRGFYDRANT
VRIVITPHTREAVAALVPGQPAYRQITALLRFYLGYESEALLEMQVHPDLMPEPLLAAGQ
ANLGLTTQLGSPPAVGHGPTRVTRVQLGRWSGATETV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
ttgttgccggcgctgttggatcaggcgcatcggatgaatttctatcgcttctgcgcgttg
atcgaactggcgtcacccgatgcagcgccgctcggcgccaccgattcgcccgcgacggat
ccggtccggttccgctcgcgtggccaacttgggtttccggcgcgcgagatcgatgcagtc
gaatacgacgcggacgatcctgcgaagccggttgcggtgcgtacgacgttccttggtttg
tacggcgtcgacgcgcggatgccggcgtacttcgtcgacgaagtggcgcagaaccgcgac
ggcgccgagccgcttgcagcgttccttgatctgtttcatcaccggatcgcgacgcagttc
taccggatctggcggaagtaccgctatccggccggctttcggcccgacggcttcgatacg
gtgtcgcgcggcgcgctcagtctcgtcggactggggttccgctcgcctgaaacgcgcgcg
ccggactgggggctgccgcgcgacgtcggcgcgcgcgcactgctgtcgatgctcgggctg
gccgcgcagaaaacgcgtaccgcggaagggctcgccggcgtgctgacacatgcgataccg
gatgccgcgatcgacgtcgaggagttctatccggtgtggcgtaccgtcaacgatttcgag
cctgcagcgctcggcgaacaatgtctgctcggacgcgggttctacgatcgggcgaacacg
gtgcgcatcgtgatcacgccgcacacgcgcgaagcggtcgccgcgctggtgcccgggcaa
ccggcataccggcagatcaccgcgttgctgcgcttctacctcggctacgaaagcgaagcg
ctgctcgagatgcaggtgcatcccgacctgatgccggaaccgttgttggccgccggtcag
gcgaacctcggcctgaccacgcagctcgggtcgccgcctgcggtagggcacggacccact
cgcgtgacacgggtgcagctggggcgctggagcggggcgacggaaaccgtataa

DBGET integrated database retrieval system