KEGG   Burkholderia sp. KJ006: MYA_4536Help
Entry
MYA_4536          CDS       T02110                                 

Definition
(GenBank) Acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00020  Citrate cycle (TCA cycle)
buk00620  Pyruvate metabolism
buk00650  Butanoate metabolism
buk01100  Metabolic pathways
buk01110  Biosynthesis of secondary metabolites
buk01120  Microbial metabolism in diverse environments
buk01130  Biosynthesis of antibiotics
buk01200  Carbon metabolism
Module
buk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
buk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:buk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MYA_4536
   00620 Pyruvate metabolism
    MYA_4536
   00650 Butanoate metabolism
    MYA_4536
Enzymes [BR:buk01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     MYA_4536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans
Motif
Other DBs
NCBI-ProteinID: AFJ88890
UniProt: I2DW64
Position
2:complement(1761140..1762624)
Genome map
AA seq 494 aa AA seqDB search
MRSLVRTADEAAAMIRPGMTVAMSGFTGSGYPKAVPAALAAHIEAAHARGETFRINVLTG
ASTAPELDGALARTDGISMRLPYQSDPTLRDKINNGEVDYQDVHLSHVAQYAWFGLYGDL
DVAIVEVAGIREDGLLIPSASIGNNKTWLEQAKHVILEVNSRQPLGLDGMHDVYYGTALP
PHRKPIPLTKSDDRIGEPYLRCPAEKIVAIVETDAPDRSNAFSAPDATSKQIATQLIDFL
RHEVKRGRLPENLLPLQSGVGNITNAVLAELSTAGFSNLTAYTEVIQDGMLDLLDDGTLS
FASATALSLSPPAVQRFADEIATFREKILLRPQEISNHPELVRRLGCIAMNGMIEADIYG
NVNSTHVMGTKIQNGIGGSGDFARNGYLSCFMSASTAKGGAISRIVPMASHVDHTEHDVA
VVVTEQGLADLRGLSPKQRARKIIANCAHPDYRPMLEDYFERASRESFGKHTPHLLAESL
SWHERFVRTGSMKV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
ttgcgttcgctcgtccgcaccgccgacgaagccgccgcgatgatccgtcccggcatgacc
gtcgcgatgagcggcttcaccggctccggctatccgaaggccgtgccggccgcgctcgcc
gcgcacatcgaggcggcccacgcccgcggcgaaacgttccggatcaacgtgctgacgggc
gcgtcgaccgcgcctgaactcgacggcgcgctcgcccgcaccgacggcatctcgatgcgt
ctgccgtaccagtccgacccgacgctgcgcgacaagatcaacaatggcgaagtcgattac
caggacgtccacctgagccacgtcgcccagtacgcatggttcggcctgtacggcgatctc
gacgtcgcgatcgtcgaagtcgcgggcatccgcgaggacggcctgctgattccgtccgcg
tcgatcggcaacaacaagacgtggctggagcaagccaagcacgtgatcctcgaagtcaac
tcgcgccagccgctcggcctggacgggatgcacgacgtctattacggcaccgcgctgccg
ccgcaccgcaagccgattccgctcacgaagagcgacgaccgcatcggcgaaccgtacctg
cgctgcccggccgagaagatcgtcgcgatcgtcgaaaccgacgcgcccgatcgcagcaac
gcgttctccgcaccggacgccacgtcgaagcagatcgcgacgcaactgatcgacttcctg
cgtcatgaagtgaagcgcggccggctgccggaaaacctgctgccgctgcagtcgggcgtc
ggcaacatcaccaacgcggtgctcgccgaactgagcacggccggcttctcgaacctcacc
gcgtacaccgaggtgatccaggacggcatgctcgacctgctcgacgacggcacgctgagc
ttcgcgtcggccaccgcgctgtcgctgagcccgccggccgtgcagcgtttcgccgacgag
atcgcgacgttccgcgaaaagatcctgctgcgtccgcaggagatcagcaaccatccggaa
ctcgtgcgccgcctcggctgcatcgcgatgaacgggatgatcgaagccgacatctacggc
aacgtgaactcgacgcacgtgatgggtacgaagatccagaacggcatcggcggctcgggc
gacttcgcgcgcaacggctatctgtcgtgcttcatgtcggccagtaccgcgaagggcggc
gcgatctcgcggatcgtgccgatggcgagccacgtcgatcataccgagcacgacgtcgcg
gtggtcgtcaccgagcagggcctcgccgatctgcgcggcctgtcgccgaagcagcgcgcg
cgcaagatcatcgcgaactgcgcgcacccggattaccggccgatgctcgaggactacttc
gagcgcgcgtcgcgcgagagcttcggcaagcacacgccgcatctgctcgccgagtcgctg
tcgtggcacgagcgcttcgtgcgcaccggctcgatgaaggtctga

DBGET integrated database retrieval system