KEGG   Burkholderia sp. KJ006: MYA_4713
Entry
MYA_4713          CDS       T02110                                 

Definition
(GenBank) Type VI secretion lipoprotein/VasD
  KO
K11906  type VI secretion system protein VasD
Organism
buk  Burkholderia sp. KJ006
Pathway
buk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:buk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    MYA_4713
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:buk02044]
    MYA_4713
Secretion system [BR:buk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   MYA_4713
SSDB
Motif
Pfam: T6SS-SciN Herpes_IE2_3
Other DBs
NCBI-ProteinID: AFJ89065
UniProt: I2DWN9
Position
2:complement(1951861..1952511)
AA seq 216 aa
MDNNQMSILRIPIGRSFVGAVATVVVVATAGCGVGQAVKDSTVDAAKWAFTTQVKTMNLD
LVARSSLNANAAGQPLSTVVRLYQLKDAKTFEQLDYTQLQTNDLEALKADLLATKDVVLR
PGASASVVEPMNPDAQVVGVVAFFREPGDGAVWKLAVPKKQWKKTDPVKIEVRDNTLNLV
GTKDRPITHTAPQQSAPAAPKPIPKATTQSGTQDEG
NT seq 651 nt   +upstreamnt  +downstreamnt
atggacaacaatcagatgagcattttaaggataccgattggacgaagcttcgtcggtgca
gtggccaccgtggtggtcgttgcgacggccggttgcggcgtcggccaggccgtgaaggac
agcacggtggacgctgcgaaatgggccttcacgacgcaggtgaagacgatgaacctggac
ctcgtcgcccgctcatcgctcaacgccaacgcggccgggcagccgttgtcgacggtggtg
aggctctatcagttgaaggacgcgaagaccttcgagcaactcgactatacccagttgcag
accaacgatctcgaggcgctgaaggcggatctgctcgcgaccaaggacgtcgtgctgcgc
ccgggcgcgagcgccagcgtggtcgagccgatgaacccggacgcacaggtggtcggcgtc
gtggcgttcttccgtgagccgggggacggcgcggtgtggaaactggcggtgccgaagaag
cagtggaaaaagaccgatccggtgaagatcgaggtgcgcgacaacacgctcaatctggtc
ggtacaaaggatcggccgataactcacaccgcgccccagcagagcgcaccggccgcgccc
aagcccatacctaaagcaaccactcaatccggcacacaggatgaaggatga

DBGET integrated database retrieval system