KEGG   Burkholderia sp. KJ006: MYA_4714
Entry
MYA_4714          CDS       T02110                                 

Definition
(GenBank) Type VI secretion protein ImpH/VasB
  KO
K11895  type VI secretion system protein ImpH
Organism
buk  Burkholderia sp. KJ006
Brite
KEGG Orthology (KO) [BR:buk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:buk02044]
    MYA_4714
Secretion system [BR:buk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   MYA_4714
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: AFJ89066
UniProt: I2DWP0
Position
2:complement(1952558..1953574)
AA seq 338 aa
MLLPALLDQAHRMNFYRFCALIELASPDAAPLGATDSPATDPVRFRSRGQLGFPAREIDA
VEYDADDPAKPVAVRTTFLGLYGVDARMPTYFVDEVAQNRDGAEPLSAFLDLFHHRIATQ
FYRIWRKYRYPAGFRPDGFDTVSRGVLSFVGLGFRSPDTHAPDWGLPQGVGARTLLSMLG
LAAQKTRTAEGLAGVLTHAIPDAAIDVEEFYPVWRTVNDFEPAALGEQCLLGRGFYDRAN
TVRIVITPHTRESVTALVPGQPAYRQITALLRFYLGYESEALLEMQVHPDLMPEPLLAAG
QANLGLTTQLGSPPAVGRGPTRVTRVQLGRWSGATETV
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgttgttgccggcgctgttggatcaggcgcatcggatgaatttctatcgcttctgcgcg
ttgatcgaactggcgtcacccgatgcagcgccgctcggcgccaccgattcgcccgcgacg
gatccggtccggttccgctcacgtggccaacttgggtttccggcgcgcgagatcgatgca
gtcgaatacgacgcggacgatccggcgaagccggttgcggtgcgtacgacgttcctcggt
ctgtacggcgtcgacgcgcggatgccgacgtacttcgtcgacgaagtggcgcagaaccgc
gacggcgccgagccgctgtcggcgttcctggacctgttccaccatcgtattgcgacgcag
ttctaccggatttggcgcaagtatcgctatccggccggtttccggccggatggcttcgac
acggtctcccgcggtgtgctcagctttgtcggtcttgggttccggtcgccggacacacat
gcgcctgactgggggctgccgcagggcgttggtgcgcgaacgctgctgtcgatgctcgga
ctagccgctcagaagacgcgtaccgcggaagggctcgccggcgtgctgacacatgcgata
ccggatgccgcgatcgacgtcgaggagttctatccggtgtggcgtaccgtcaacgatttc
gagcctgcagcgctcggcgaacaatgtctgctcggacgcggattctacgatcgggcgaac
acggtacgcatcgtgatcacgccgcacacgcgcgaatcggtcaccgcgctggtgcccggg
caaccggcataccgacagatcaccgcgttgctgcgcttctacctcggctacgaaagcgaa
gcgctgctcgagatgcaggtgcatcctgacctgatgccggaaccgttgttggccgccggt
caggcgaacctcggcctgaccacgcagctcgggtcgccgcctgcggtagggcgcggaccc
actcgcgtgacacgggtgcagttggggcgctggagcggggcgacggaaaccgtataa

DBGET integrated database retrieval system