KEGG   Burkholderia sp. KJ006: MYA_4722Help
Entry
MYA_4722          CDS       T02110                                 

Definition
(GenBank) type VI secretion protein ImpJ/VasE
  KO
K11893  type VI secretion system protein ImpJ
Organism
buk  Burkholderia sp. KJ006
Brite
KEGG Orthology (KO) [BR:buk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:buk02044]
    MYA_4722
Secretion system [BR:buk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   MYA_4722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: AFJ89074
UniProt: I2DWP8
Position
2:1967674..1969080
Genome map
AA seq 468 aa AA seqDB search
MNAFRRAPLHRYFHSRTTNKMKITRPLWAKGIFMTPQHFQQQAIWEQYVHDRVARIASPD
AWGAVHVALDSEALSVNRLQCTALGLRLPDGTLIDSETADWLPAARSLDDVPTTVDSVTV
LAGVALMDAQGGNCVEPGEKPARPRRVTREYKHVADLNGDGQEEITVERNVVALLFDFEQ
AGDYVTCPIARLVRTPQGRFEQDKSFVPPCLFLSASDRLVHRAQRISEILSAKSASLAVR
RKERSDQIADFAVSDVALFWLLHSVNSTWPELARLVQAPDQHPERLYAVLARLAGSLLTF
STTESLQAIPLYDHHAPEPMFAELESLIRTLLDAVIPSRVVPIALERVRATTWLGRINDE
RLTEGAEYYLSVQAAMPAHALIEHLPRLCKVGAPDEVEQIVNSALLGIALRPMSRLPAAI
PVRIENQYFALDSNDAAFKRMIDAHACQIYVPASIPEASLELYAVLPS
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgcgttccgtcgcgcacctctacaccgctacttccattccagaacaaccaacaag
atgaagataaccagaccgctgtgggccaaggggattttcatgacgccgcagcacttccag
cagcaggcgatatgggaacaatacgtccatgaccgtgtagcccgtatcgcaagccccgac
gcttggggtgccgtccacgttgcgctcgacagcgaagcactgagcgtcaatcgactgcag
tgcacggcgctcgggctgcgcctgccggacggtacgctgatcgatagtgaaacggccgac
tggcttcctgcggcacgcagtctcgacgacgtgccgacaacggtcgacagcgtgaccgtg
cttgctggtgtagcactgatggacgctcagggcggcaactgcgtcgaacccggcgaaaag
cctgcgcggccgcggcgcgtgacccgcgaatacaagcacgttgccgatctgaacggcgac
ggacaggaagaaatcaccgtcgagcgcaacgtggtagcccttctgttcgacttcgagcag
gccggagactacgtcacctgtccgatcgcgcggctcgtgcgcacgccacaagggcggttc
gaacaggacaagagcttcgtcccgccgtgcctgttcctgtcggcgagcgatcgcctcgtg
catcgcgcgcagcgcatctccgaaatcctgtctgccaagagcgccagccttgcagtgcgc
cgcaaagagcgctcggatcagatcgccgatttcgccgtgtccgacgtggcgctcttctgg
ctgttacatagcgtgaatagcacctggcccgaactcgcccgtctcgtacaggcgccggac
cagcatccggaacggctctacgccgtgctcgcccgcttggccggctcactgctgacgttc
tctacgaccgagtcgctccaggcgattccgctatacgatcaccacgcgccggagccgatg
tttgccgagctcgaatcgctgatcagaacactgctcgacgccgtgattccgtcccgagtc
gtgccgattgcactcgagcgcgtgcgcgcgaccacatggctcggccgaatcaacgacgag
cggctgacggagggcgctgaatactatctgtcggttcaggccgccatgcccgcacacgcc
ctcatcgagcacctgccgcgcctctgcaaggtcggcgcaccggacgaagtcgagcagatc
gtcaattccgcgctgctcggcatcgcgctgcgcccgatgtcgcgcctgcctgccgcgatt
cccgtgcggatagaaaaccagtacttcgcgctggacagcaacgatgccgcgttcaagcgg
atgatcgacgcgcatgcctgccagatctacgtgccggcgtcgattcctgaagcgtcgctc
gagctgtatgcggtgctgccgtcatga

DBGET integrated database retrieval system