KEGG   Burkholderia sp. KJ006: MYA_4723
Entry
MYA_4723          CDS       T02110                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
buk  Burkholderia sp. KJ006
Pathway
buk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:buk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    MYA_4723
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:buk02044]
    MYA_4723
Secretion system [BR:buk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   MYA_4723
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: AFJ89075
UniProt: I2DWP9
Position
2:1969254..1969739
AA seq 161 aa
MINDAVYALCALLDEAALKHLTGEARESWEKRPLQEERFSRNDAGEELVRRIEDRLLEPR
SPRVLLAIFAAVLSLGFTGRFAMDGSTARAALIRTLDERLGRTTAAEDNHAAPASIVVNR
TNARPLRISPLTWVVASCVAVGVAWFMVDRWFIASIAQIAQ
NT seq 486 nt   +upstreamnt  +downstreamnt
gtgatcaacgatgcggtctacgcgctgtgcgcactgctcgacgaggccgcattgaagcac
ctcacgggagaagctcgcgaaagctgggagaagcggccgctccaggaggaacgtttctcg
agaaacgatgccggcgaggagttggtacgacgcatcgaggatcgcttgctcgagccacgg
tcgccgcgggtgctgcttgcgatattcgccgcggtgctgtcgcttggcttcaccggacgg
tttgcgatggacgggagtacagcgcgtgcggcgcttattcgcaccctcgacgaacgactc
gggcgcacgaccgcagcggaggacaaccacgcagcgcctgcttcgatcgtggtgaaccgc
accaacgcccgcccgctgcgcatttctccgctgacttgggtggtcgcctcgtgcgtcgcc
gtcggcgtcgcatggttcatggtcgatcgatggttcatcgcgtcgattgcgcagatcgcg
caataa

DBGET integrated database retrieval system