KEGG   Burkholderia sp. KJ006: MYA_4724
Entry
MYA_4724          CDS       T02110                                 

Definition
(GenBank) Type VI secretion system lysozyme-related protein
  KO
K11905  type VI secretion system protein
Organism
buk  Burkholderia sp. KJ006
Brite
KEGG Orthology (KO) [BR:buk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:buk02044]
    MYA_4724
Secretion system [BR:buk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   MYA_4724
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AFJ89076
UniProt: I2DWQ0
Position
2:1969812..1970183
AA seq 123 aa
MDDFASEVQVFLSVRDNIERILNSRRGSLAHLPDYGLDDLSEIYRHLPSSAHKLRRAIEA
TLLAYEPRLKRIEIEIHPPEPGMLISFTMACHLHQAGLVRFGTNFMPDGKTRLRMLQAAL
DRY
NT seq 372 nt   +upstreamnt  +downstreamnt
gtggacgacttcgcgtcagaagtgcaggttttcctgtcggtgcgcgacaacatcgagcgc
atcctgaatagtcggcgcgggtctctcgcgcaccttccggactacggcctagacgacctg
tcggagatctatcggcatctgccgtcctcggcgcacaagctgcggcgcgcgatcgaggcg
accctgctcgcttacgaaccgcgtctgaagcgaatagaaatcgaaattcatccgcccgag
cctggtatgttgatcagcttcacgatggcctgtcatttgcatcaggcagggctcgtgcgc
ttcggcacgaacttcatgccggacggcaaaacccgactgcgcatgctgcaggcagcgctc
gaccgatactga

DBGET integrated database retrieval system