KEGG   Burkholderia sp. KJ006: MYA_5109Help
Entry
MYA_5109          CDS       T02110                                 

Definition
(GenBank) Acetyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00071  Fatty acid degradation
buk00072  Synthesis and degradation of ketone bodies
buk00280  Valine, leucine and isoleucine degradation
buk00310  Lysine degradation
buk00362  Benzoate degradation
buk00380  Tryptophan metabolism
buk00620  Pyruvate metabolism
buk00630  Glyoxylate and dicarboxylate metabolism
buk00640  Propanoate metabolism
buk00650  Butanoate metabolism
buk00900  Terpenoid backbone biosynthesis
buk01100  Metabolic pathways
buk01110  Biosynthesis of secondary metabolites
buk01120  Microbial metabolism in diverse environments
buk01130  Biosynthesis of antibiotics
buk01200  Carbon metabolism
buk01212  Fatty acid metabolism
buk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:buk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MYA_5109
   00630 Glyoxylate and dicarboxylate metabolism
    MYA_5109
   00640 Propanoate metabolism
    MYA_5109
   00650 Butanoate metabolism
    MYA_5109
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MYA_5109
   00072 Synthesis and degradation of ketone bodies
    MYA_5109
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MYA_5109
   00310 Lysine degradation
    MYA_5109
   00380 Tryptophan metabolism
    MYA_5109
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MYA_5109
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MYA_5109
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MYA_5109
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:buk04147]
    MYA_5109
Enzymes [BR:buk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MYA_5109
Exosome [BR:buk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MYA_5109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFJ89457
UniProt: I2DXT1
Position
3:52934..54124
Genome map
AA seq 396 aa AA seqDB search
MTTQDPIVIVGAARTPMGGFQGALAAASASELGAVAIRAALERANVPAERIDEIVFGCVL
PAGQGQAPARQAALKAGLPLGAGATTVNKMCGSGMKAAMFAHDLLFAGSADVAVAGGMES
MTNAPYLLPKARAGMRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEDCAQAYAFSREAQD
DFAIASLTRAQRAIAEGRFTSEIAPVTVKAGKTEAVVSIDEQPGNAKLDKIPTLKPAFRE
GGTVTAANSSSISDGAAALVMMRRSQAERLGVTPKAVIVGHSTYANKPGLFATAPIGAIR
KLSEKTGWNLRDVDLFEINEAFAVVAMAAMRDLDLPHDKVNVHGGACALGHPIGASGARV
VVTLLAALETYGLKRGVASLCIGGGEATALAIERIA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacgacacaggacccgatcgtaatcgtcggcgcggcacgcacgccgatgggcggtttt
cagggcgcgctggccgcggccagcgcaagcgaactcggcgcagtggcgattcgcgcggca
ctcgaacgcgcgaacgtgccggccgagcgtatcgacgaaatcgtgttcggctgcgtgctg
ccggccggacagggccaggcgccggcgcggcaggccgcgttgaaggccggcttgccgctg
ggggccggcgcgacgaccgtcaacaagatgtgcggctccgggatgaaggccgcgatgttc
gcgcatgacctgctgttcgccggctcggccgacgtggccgtcgcgggcgggatggagagc
atgacgaatgcgccgtatctgttgccgaaggcgcgcgcgggaatgcgcatgggccacggt
caggtgctcgaccacatgttcctcgacggcctcgaggacgcatacgacaagggccgcctg
atgggcacgttcgcggaagactgcgcgcaggcctacgcgttttcgcgcgaggcgcaggac
gacttcgcgatcgcgtcgctcacgcgcgcgcaacgcgcgatcgcggaaggacgcttcacg
tcggagatcgcgccggtgaccgtgaaggccggcaagacggaagccgtcgtgtcgatcgac
gagcagccgggcaatgcgaagctcgacaagatcccgacgctgaagccggcgttccgcgaa
ggcggcaccgtgacggccgccaattcgtcgtcgatttcggacggcgcggccgcgctcgtg
atgatgcgccgctcgcaagcggagcggctcggtgtcacgccgaaggccgtgatcgtcggg
cactcgacgtacgcgaacaagcccggcctgttcgcgaccgcgccgatcggcgcgatccgc
aagctgtcggagaagaccggctggaacctgcgcgacgtcgatctgttcgagatcaacgag
gcgttcgcggtggtcgcgatggccgcgatgcgcgatctcgacttgccgcacgacaaggtc
aacgtgcacggcggcgcatgtgcgctcggccatccgatcggcgcctcgggcgcgcgcgtg
gtggtgacgctgctcgctgcgctcgaaacgtatgggctgaagcggggcgtcgcgtcgctg
tgcatcggcggcggcgaggcgaccgcgctcgcgatcgaacgcatcgcataa

DBGET integrated database retrieval system