KEGG   Burkholderia sp. KJ006: MYA_5750Help
Entry
MYA_5750          CDS       T02110                                 

Definition
(GenBank) Type VI secretion protein, VC_A0110 family
  KO
K11896  type VI secretion system protein ImpG
Organism
buk  Burkholderia sp. KJ006
Brite
KEGG Orthology (KO) [BR:buk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:buk02044]
    MYA_5750
Secretion system [BR:buk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   MYA_5750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-ProteinID: AFJ90089
UniProt: I2DZL3
Position
3:complement(770901..772721)
Genome map
AA seq 606 aa AA seqDB search
MDAERITQQDDPFLKYFDSEMRYLREAGREFAEAQPQAARQLGMTSPGARDERVEAAYAG
FAFLASRLRMKLDDALPEVTDPLIDHLWPHAGRTIPSLAILQCEPRTGEARILDTLPAGL
RVRSTPIGSDATVCVYRTTQPVRLLPLEIREAGVRMREDGRTVIRLAFNLLHREQRLLDD
LSRIRLYLHGDRPTASALYAVFTRQVESVGVRMPRVLDGQLQPQPDVRFEAAGFGPDTRL
WPVGHGARDAELDREQTLLEYFSFPEKFHFVDLCGFNTASVPSGETRMEFEIVIDGRMAG
DVTFDADNIRLFCTPVINLFEVDAQAIRPNAHDRDYPVRPPVSAGDHVEPYDALSVVAAD
PRNAMQFEYQSFKEFRHRGGMMRYESPERYYHSSIRHGVTGQREMWITLGGHLWDEPDSL
PDGHVTVRVLANNGRLPRMALRESMITEPVSAFAGVERVRNLTAPTMPLYPPRGSEYDWK
VVSHFNAMGSTELNMMDASVLRGALSLYDWSPQDDNRRRIEAIRDVWLDEDTEIVGARVD
RIMNVNVGIEPSSFAGPGDVALFGDVMSRFVGRYACFHYAVRLVLHEGVGGPVRRYPSAV
KAGGWL
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggatgccgagcggataacgcagcaagacgatccgtttctgaagtatttcgattcggaa
atgcgctacctgcgcgaagcgggcagagaattcgccgaagcgcagccacaggccgcgcgc
caactggggatgacttcgcccggtgcacgggacgagcgagtggaagctgcatacgcgggc
ttcgcatttctagcgagtcggctgcgaatgaagctcgatgatgcgctgccggaagtgact
gatccgctgatcgaccatttgtggccgcatgcgggccgtaccattccgtcgctggcaatc
cttcagtgcgagccacgcacgggcgaggcccggattctggataccttaccggcggggctg
cgggtgcgctccacgccgattgggtccgacgcgacggtgtgtgtctatcgcaccactcaa
ccggtacgcttgctgccgctcgagatccgcgaagccggcgtgcggatgcgagaggacggc
cgcacggtgatccggcttgcattcaatctgctgcatcgcgagcagcgtctgctcgacgat
ctgtcgcgcattcgcctgtatctccatggtgatcggccgaccgcatcggcgctgtatgca
gtgttcacacggcaggtcgaatcggtcggtgtgcgtatgccacgcgtgctcgacggtcag
ttgcaaccacaaccggatgtgcgtttcgaggcggccggattcggtcccgatacgcgattg
tggccggtcggccacggcgcccgcgacgccgagctcgatcgtgaacagacactgctcgag
tatttctcgttcccggaaaaattccacttcgtcgacctctgcggattcaacacggcaagc
gtgccgtccggtgagacgcgcatggagttcgagatcgtgatcgacggccgcatggccggc
gacgtgacgttcgacgcggacaatatccgtctgttctgcacgccggtgatcaacctgttc
gaagtggatgcgcaggcgattcgccccaatgcccatgaccgcgattatccggtacgtcca
cctgtttccgctggcgatcatgtcgagccctacgacgccttgtcggtcgtggcagccgat
cctcgcaatgcgatgcaattcgaataccagtcgttcaaggagtttcggcaccgcggcggg
atgatgcgctacgagtcgcccgagcgctattaccactcgtcgattcgtcacggcgttacc
ggccagcgagagatgtggatcacgctcggcggccatctatgggatgaacccgacagcctg
ccggacgggcacgtaacggttcgggtgctggcaaataatggccgtttgccgcgtatggcg
ctacgcgaatcgatgattaccgagccggtatcggcgtttgctggtgtcgagcgggtgcgc
aatctcacggcgccgacgatgccgctttatccgccgcgtggcagcgaatacgactggaaa
gtcgtttcacacttcaatgcgatgggttcgactgaactcaacatgatggatgcgagtgtg
ctgcgcggtgcgctgtcgctgtacgactggtcgccacaggacgataaccggcggcgtatc
gaggcgattcgcgatgtgtggctggacgaagacactgaaatcgtgggtgcacgcgtcgac
agaatcatgaacgtgaatgttggcatcgagccatcgagcttcgccggtccgggcgatgtc
gcgctgttcggcgacgtgatgagccgcttcgtcggtcgttacgcctgtttccattacgcg
gtgcgactcgtgctgcatgaaggtgtgggtggaccggttcgccgttatccaagcgcagtc
aaggcgggaggttggttgtga

DBGET integrated database retrieval system