KEGG   Burkholderia sp. KJ006: MYA_5760
Entry
MYA_5760          CDS       T02110                                 

Definition
(GenBank) Type VI secretion-associated protein, VC_A0119 family
  KO
K11910  type VI secretion system protein VasJ
Organism
buk  Burkholderia sp. KJ006
Brite
KEGG Orthology (KO) [BR:buk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:buk02044]
    MYA_5760
Secretion system [BR:buk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   MYA_5760
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N
Other DBs
NCBI-ProteinID: AFJ90097
UniProt: I2DZM1
Position
3:complement(788164..789744)
AA seq 526 aa
MKLGGLFQKLFPARVDAEQLVQARLDAWNAWLLPLAGDGGVGRDPGYEDMFFELREETQK
LSGIDDGLIVRSCEQLLKETGKDLRLAGYYAFARLRQDGPAGFADALELAAALVDRFGEA
VLPARAEAKKGALEMLATARVVDLLDSRGAFLPADLERALAALDVLVAGTSTWPEAARPN
LQPLVVRFERSGEPVRSAEAEAVASTIPFASTSTSTIASTRDLLDQARAMAVWLRDQENG
YLPSVRLVRSVRWDTLHEVPPTDAAARTRLVPPRGELRQQMKRLVLQKQWHELLERVEGA
FMEGVNHLWFDLQYFQHVALDHVGAPHNAWSELLRADFALFLERLPGIERLAFNDGTPFA
EDATLEWIARHAVVRDLEAGEAVAPLPVSADSEGDAGDWPEIEAQARDLAVREGVEAAFA
WLEALPGMKTDRHRYLQRLVMARLADHAGRPDTAHALLAELDMHSRSLPLVRWEPALVFE
VKQQLVRALKAMSARKDADKPTLARRIGELQAELTVLDPGRALTLS
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgaaactcggcggactgttccagaagcttttccctgctcgcgtcgacgccgagcagttg
gtgcaagccaggctcgatgcctggaatgcgtggttgctgccgcttgcgggcgacggcggc
gtcggccgcgatccaggctacgaggacatgtttttcgaactgcgcgaggagacgcagaag
ctttccggcatcgacgacggcctcatcgtcaggtcctgcgagcaattgctcaaggaaacc
ggcaaggatctgcgtctggccggctactacgcatttgcgcggctgcggcaggacggcccc
gcaggcttcgcggacgcgctcgaactcgcggccgcgctcgtcgatcgtttcggcgaggcc
gtgctgcccgcgcgcgcggaggcgaagaagggcgcgctcgaaatgctcgccaccgcacgt
gtggtcgacctgctcgacagccgcggcgcattcctgccggccgacctcgagcgtgcactc
gccgcgctcgatgtgctcgtcgcggggacgagcacatggccggaagccgcgcgtccgaac
ctgcaaccgctcgtcgtgcgtttcgagcgcagcggcgaacccgtgcgcagcgcggaggcg
gaagcggttgcgtcgacgataccgttcgcgtcgacgtcgacgagcaccatcgcatcgaca
cgcgacctgctggatcaggcgcgtgcgatggcggtctggttgcgcgatcaggagaacggc
tacttgccgtcggtccggctcgtgcgcagcgtccgctgggacacgctgcacgaggtgccg
ccgacggacgccgccgcacgtacgcggctcgtgccgcctcgcggcgagctgcgccagcag
atgaagcggctggtcttgcagaagcagtggcacgaactgctcgaacgcgtcgaaggggcg
ttcatggagggcgtgaatcacctctggttcgatctccagtatttccagcacgtcgcgctc
gaccatgtcggtgcgccccataacgcgtggagcgagctgctgcgcgcggacttcgcgcta
ttcctcgagcgcctgcccggcatcgagcggctggcattcaacgacggcacgccgttcgcc
gaagacgcgacgctcgaatggattgcgcgccacgcggtcgtgcgcgacctcgaagcgggc
gaggccgtggcgccgttgccggtgtcggccgatagcgaaggcgatgccggcgactggccg
gaaatcgaagcgcaagcgcgggatctcgccgtgcgcgaaggcgtggaggcggcattcgcg
tggctcgaggcgctgcccggcatgaagaccgatcgtcatcgctacctgcagcggctcgtg
atggcgcgcctggccgatcatgccggccggcccgataccgcgcacgccctgcttgccgag
ctcgatatgcattcgcgatcgctgccgctggtccgctgggagccggcgctggttttcgag
gtcaagcagcaactcgtgagggcgttgaaagcgatgagtgcccgcaaggacgccgacaag
ccgacgcttgcgcgccgcatcggcgaactgcaggccgagcttaccgtgctcgatcccggt
cgggcactgacactttcataa

DBGET integrated database retrieval system