KEGG   Burkholderia sp. KJ006: MYA_5761Help
Entry
MYA_5761          CDS       T02110                                 

Definition
(GenBank) Putative membrane protein
  KO
K11891  type VI secretion system protein ImpL
Organism
buk  Burkholderia sp. KJ006
Pathway
buk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:buk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    MYA_5761
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:buk02044]
    MYA_5761
Secretion system [BR:buk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   MYA_5761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related IcmF_C
Motif
Other DBs
NCBI-ProteinID: AFJ90098
UniProt: I2DZM2
Position
3:complement(789741..792617)
Genome map
AA seq 958 aa AA seqDB search
MNVTDFGSETSSPDEAIGFTWSNARVNAAEIDASLQDLAYCLAEAGVVRLTKDAHDRYPA
ELSQHISNLSGALSGLVVQTTHSRAWRHAIHGLLFAPLFKERELAPAAPVDANGDEPAVG
PQHRTIWQTVGEHSRKIHGRRVGFSLSTAAAWFATALMGCWIAGTTLSGFVNRATIQDAA
DTVTNLAMVQDRTRALQGLNDLDRQVDTLEFHQREGAPWTSRFGLNRDAALLDALWPNYA
DAASRILVGPIRQKLEERLHQLASLSDAQIASGGNTQIQASYDTLKAYLMLAKPQRAVAP
FLTPLLAATAVPSRPANSTMSSGAWEDLRLHAIAFFATHLGRDTASNTSALAIVPDGNLI
ASTRQTVIGVRGIQNSTDALYRQIVDEATPKYSPITLATLLGDTTSRGLFNTTANVPGVF
TRAAWEERISKSIDDASAQRDVSGDWVLSDAKASNQTPSTLKAELRQRYFEDYARAWALF
LNSLRWQSAPTLSATADQLTLLGDPQRSPLVALMNAVVYQAGTGANTQSLSDSLINKAQQ
LVGATEKDPAKQAQPPLAPLAAAFGPILRLTGSDLVSGAPANGKAAAQLAATGDLSLARY
LERVTAMRLKASQIVAGADPDAIARLAAQSVLQGKTSDIADSRDYASRVAASLGEQWSGF
GELLRAPFDQSWQVVVQPAASSLNEIWRTAIVADWNKTFGARYPFADSDNDASLPEMARF
MRPDNGVIAQFVATQLAGVVERQGDRWVAAQGADHGALTIDPSFLNALNKLTRISTVLFP
AGDAHVRYELQAVPTPGVTDMKFVLSGRELHYFNQKQEWMPFEWPGQSLENLSHIEWQTE
RGGLRTALDSQGRFGLIRLLERAKVSQQDSARYLLTWTPDTSQGIPLKVQLRSEAGAGPL
DVLQLRNFTLPARVFLTGSAKSGPKLSGASPPPLPRSMIEAAKHAAVPLPRGALSEVE
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgtcaccgacttcggtagcgaaacgtcaagccccgacgaagcgatcgggttcact
tggtcaaacgcgcgcgtgaacgcagccgagatcgacgcgtcgctgcaagacctcgcttac
tgcctcgcggaggccggcgtcgtgcgtctcaccaaagatgctcacgaccgctaccccgct
gagctatcgcaacatatctcgaacctgagcggagcactgtccggtctcgtcgtgcaaacc
acccactcccgtgcctggcgacatgccattcacggcctgctgttcgcgccgctattcaag
gaacgggagttggcgccggcggcgcccgtcgacgccaacggcgacgagccagcggtcggc
ccgcaacatcgaaccatctggcagaccgtcggcgagcacagccgcaagattcacggccgc
cgagtaggcttctcgctttctaccgcggccgcatggttcgcaacggccctcatgggttgc
tggatcgctggcacgacgctgtccggattcgtcaaccgtgcaacgattcaggacgcggca
gacacggtcacgaatctcgccatggtgcaggatcgcacacgggcattacagggcttaaat
gacctggatcgacaagtcgacacgctcgaattccaccaacgcgaaggcgccccatggacg
tcgcggttcggtctgaaccgcgatgccgcgctgctcgacgcgctctggccaaactatgcc
gatgctgcgagccgcatcctggttggcccgatccgtcagaagctcgaggaacgcctgcat
cagctcgcgtccctgtccgatgcgcagattgccagcggtggcaatacacagattcaggcc
tcctatgacacgctcaaggcttacctgatgctcgcgaagccccagcgggccgtcgctccg
ttcctgacgccgctgcttgccgctacggccgtgccttcacgtccggccaactcgaccatg
tcgtcaggtgcctgggaagatttgcgtctccatgcgatcgcgttctttgcaacgcatctc
ggccgagacaccgcgtcgaatacctccgcgctcgcaatcgttccagacggcaacctgatt
gcgtcgacccgccaaacggtaattggcgtgcgcggcatccagaattcgacggatgcgctc
taccgccagatcgtcgacgaagctacgcccaagtactcgccgattaccctcgccacgctg
ctcggcgacacgacgagtcgtggcctgttcaacacgacggcgaacgtccccggcgttttc
acgcgcgccgcgtgggaagaacgcatttcgaaatcgatcgacgacgccagcgcgcagcgc
gacgtgtcgggcgactgggtgctgtctgacgcaaaggccagcaaccagacgccgtcgacg
ctgaaggccgaactgcgccagcgctacttcgaggattacgcgcgcgcgtgggcgctattc
ctcaacagcctgcgctggcaatctgcaccgacgctgtcggcgacagccgatcaattgacg
ctgctgggcgacccgcagcgctcgccgctcgtcgcgttgatgaacgcggtcgtctaccag
gcgggcacgggcgcgaatacgcagtcgctgtcggacagcctgatcaacaaggcgcagcag
ctcgtcggcgcgacggagaaagatccggcgaagcaggcccagccgccgctcgcgccgctg
gccgccgcctttggtccgatcttgcgcttgaccggcagcgatctggtgtcgggcgccccg
gcaaacggcaaggcagccgcgcaactcgccgcgaccggcgacctgagtctcgcgcgctac
cttgagcgcgtgaccgcgatgcgtctgaaagcatcgcaaatcgtcgccggcgcagatccg
gacgcgatcgcgcgcctcgctgcgcagtccgtgctgcaaggcaagacatccgacatcgcc
gacagccgcgactacgcgagccgcgtggccgcgagcctcggcgaacaatggtcgggtttc
ggcgaactgcttcgcgcaccgttcgatcaatcctggcaggtcgtcgtgcaaccggccgcg
tcgagcctgaatgaaatctggcgcacggcgatcgtggccgactggaacaagacgttcggt
gcgcgctatccatttgcagactcggacaacgacgcgtcgctgcccgaaatggcgcgcttc
atgcggcccgacaacggcgtgatcgctcagttcgtcgcgacgcagctggccggcgtcgtc
gaacggcagggcgaccgttgggtggccgcgcaaggagccgaccatggcgcgttgacgatc
gatccatcctttctgaacgcgctgaacaagctgacgcgcatctcgaccgtgctgttcccg
gccggcgacgcgcacgtgcgctacgaactgcaagcggtacccacaccgggcgtgaccgac
atgaagttcgtgctgtccggccgcgaactgcattacttcaaccagaagcaggaatggatg
ccgttcgaatggccgggccagtcactggagaatctgtcgcacatcgaatggcagaccgag
cgcggcggtctgcgcaccgcgctggattcgcaaggccgcttcggcctgatccggctgctg
gagcgcgcaaaggtgtcgcagcaggacagcgcgcgctatctgctgacctggacgcccgat
acgagccagggcattccgctcaaggttcagttgcgcagcgaggccggcgcgggtccgctc
gacgtgctgcagctgcgcaatttcacgttgccggcgcgggttttcctgacgggttcggcc
aagtcgggaccgaaactttcgggcgcgagtccgccgccgctgcctcggtcgatgatcgaa
gcggcgaagcatgccgcggtaccgctcccgcgtggcgcattgtcggaggtcgaatga

DBGET integrated database retrieval system