KEGG   Burkholderia sp. KJ006: MYA_5768
Entry
MYA_5768          CDS       T02110                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
buk  Burkholderia sp. KJ006
Pathway
buk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:buk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    MYA_5768
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:buk02044]
    MYA_5768
Secretion system [BR:buk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   MYA_5768
SSDB
Motif
Pfam: DotU UreF
Other DBs
NCBI-ProteinID: AFJ90105
UniProt: I2DZM9
Position
3:805598..806329
AA seq 243 aa
MKALKLNRPAAALMQGAAGPGNAPADGIRDLLRDTALLVTTLTSGGQVPDAIALRARCKQ
LVEQFASALERRGFPDDVRNEALVAQCGLLDEAALRHLPAESRSGWEQKPLQVEQFNLHE
AGERVFERLDARMREASPSVALLECYAAILGMGFVGRYAREGEAKRAALIASLNAKLETL
RPPSERPFIADRAGRRLSDWFYRLSPWAIAGLAVIAAAIVWGVWSAVLDAQLAQLIATKA
VRP
NT seq 732 nt   +upstreamnt  +downstreamnt
atgaaagccctgaagctcaatcgacccgctgcagcgctgatgcaaggcgcggcaggcccg
ggaaacgcgcccgccgacggcattcgcgacctgctgcgcgatacggcgctgctggtcacg
acgctgacgtcgggcggacaggttccggacgcaatcgccctgcgcgcccgctgcaagcag
ctcgtcgagcagttcgcgagcgcgctggagcgccgcggttttcccgacgacgttcgcaac
gaggcgctggtcgcgcagtgcgggctgctcgacgaggccgcgctgcggcatttgcctgcc
gaatcgcggtcgggatgggaacagaagccgctgcaggtcgaacagttcaacttgcacgag
gccggtgagcgggtgttcgagcgactcgacgcgcgcatgcgggaagcgtcgccgtcggtg
gccctgctcgagtgctacgcggcgattctcgggatgggcttcgtcggccgctacgcgcgc
gagggcgaagcgaaacgcgccgcgttgatcgcatcgctcaatgccaagctggagacgctg
cgcccgccgtccgagcggccgttcatcgcggatcgtgccgggcggcgtctctccgactgg
ttttaccggctgtcgccatgggccatcgcgggcctcgccgtgattgcggcggcgatcgta
tggggcgtctggtccgccgtgctcgacgcgcaactcgcgcagctgatcgcaacgaaggcc
gtccgcccgtga

DBGET integrated database retrieval system