KEGG   Burkholderia sp. KJ006: MYA_5770Help
Entry
MYA_5770          CDS       T02110                                 

Definition
(GenBank) Hemolysin-coregulated protein Hcp
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
buk  Burkholderia sp. KJ006
Pathway
buk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:buk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    MYA_5770
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:buk02044]
    MYA_5770
Secretion system [BR:buk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   MYA_5770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: AFJ90107
UniProt: I2DZN1
Position
3:808145..808630
Genome map
AA seq 161 aa AA seqDB search
MAIPAYAWFKDDGGADIKGSVTVQDREGSVEVVAFDHGVHIPTDGNTGKLTGTRVHAPIT
FTKETDASTPYLYKAVTSGQTLKSVEIKWYKIDDAGKEKEYFNTKLDNVKIVAVRPKMLD
IKIPDYEKHNHLEEVELRYETITWSYKDGNIVHKDTWNERS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcaattcccgcatatgcgtggttcaaggacgacggcggcgccgacatcaagggttcg
gtcacggttcaggaccgcgaaggcagcgtcgaagtcgtcgcgttcgatcacggcgtgcat
atcccgaccgatggcaacacgggcaagctgacgggcacgcgcgtccacgcgccgatcacg
ttcacgaaggaaaccgacgcgtccacgccgtacctgtacaaggcggtgacgagcggccag
acgctgaagtcggtcgagatcaagtggtacaagatcgacgacgcgggcaaggagaaggag
tacttcaacacgaagctcgacaacgtcaagatcgtcgcggtgcgtccgaagatgctcgac
atcaagatcccggactacgagaagcacaatcacctcgaagaagtcgagctgcgctacgaa
acgatcacctggtcgtacaaggacggcaacatcgttcacaaggacacgtggaacgagcgt
tcctga

DBGET integrated database retrieval system