KEGG   Burkholderia sp. KJ006: MYA_5771
Entry
MYA_5771          CDS       T02110                                 

Definition
(GenBank) Type VI secretion ATPase, ClpV1 family
  KO
K11907  type VI secretion system protein VasG
Organism
buk  Burkholderia sp. KJ006
Pathway
buk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:buk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    MYA_5771
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:buk02044]
    MYA_5771
Secretion system [BR:buk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   MYA_5771
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 ClpB_D2-small AAA_16 AAA_22 AAA_24 Clp_N Sigma54_activat IstB_IS21 AAA_25 NACHT AAA_7 TniB AAA_18 ATPase_2 RsgA_GTPase Phage_cap_E CxC7 Hpr_kinase_C
Other DBs
NCBI-ProteinID: AFJ90108
UniProt: I2DZN2
Position
3:808770..811493
AA seq 907 aa
MISRDTTHLLRRLNTHCAKALEAAASLCLGRMTDEITVEHWLLKLIEAGDGDIPAILRHY
AIDVDKVWDALIASIDRLPRNLRGKPAISLQLATVLQDAWLQASPDGEDTSIRSGNLLQA
IVATPYVLRAQDAWPLLSISSAQIERLLPRLAHRSCESRVEPEAMADADADTPSASDEPH
GQADEHATEAASVRSRSTDGEALARFAIDLTDKARRGDIDPVFGRDREIQQMVDVLARRR
KNNPILVGEPGVGKTALVEGLALRVANKDVPNVIRDVRILTLDLGLLQAGAGVKGEFEQR
LKNVIDEVQASPEPILLFIDEAHTLIGAGNAAGGADAANLLKPALARGELRTIAATTWSE
YKQFFERDAALERRFQIIKVDEPDDDAACLMLRGLKNHYAKYHHVHIRDEALVAAVKLSR
RYIPARQLPDKAVDLIDTAAARVRMGLETPPAELQRARAAVSALELEQTTLDADAQAGID
GIENRREVLARALSDARNALTLLQTRYTTELELVQLVHEQRAAKENAEAVAELGSLDDAQ
QLLADVQGKAPLVFVDVDAAAIARVVAEWTGVPVGSLVEDELQSLLTLERQLATRVVAQD
DALGALAESLRTAKAGLKNENAPLGVFLLAGPSGVGKTETALALADLLFGGEAALTTINM
SEYQEAHTVSQLKGSPPGYVGYGRGGVLTEAVRQRPYSVVLLDEVEKAHRDVLDMFYQVF
DRGTMRDGEGREIDFRNCVILMTSNLGSAQIDDATADDPHITQAALLDAIHPQLVAHFQP
ALLARFQSLVYRPLDAAALSSIVRLKLAKVAERLRRQHDVELSCDDALIGSMAELCLARE
SGARNVDAFLNQRILPTVSRELLARMAAGDMPAKIVLSSSADGNLTIDFVARDAVAAGPS
EPASAAA
NT seq 2724 nt   +upstreamnt  +downstreamnt
atgatctcgcgcgataccactcacctgctccgccggctcaatacgcattgcgcgaaggcg
ctcgaagcggcagccagtctgtgcctggggcgaatgacggatgaaatcaccgtcgagcac
tggctgttgaaactgatcgaggcaggtgatggcgacatcccggcgattcttcggcactac
gcgatcgacgtcgacaaggtgtgggacgcgctgatcgcgtcgatcgatcggctgccgcgc
aatctgcgcggcaagccggcgatctcgctgcaactggcgaccgtcctgcaggacgcgtgg
ctacaggcgtcgcccgacggcgaagatacgtcgatccggtccggcaacctgttgcaggcg
atcgtcgccacgccatacgttctgcgcgcgcaagacgcctggccgctgctgtcgatcagc
agcgcgcagatcgagcgcctgctgccgcgcctcgcgcatcgatcctgcgaaagccgcgtc
gaacccgaagcgatggccgacgcggatgccgacacgccgtctgcgagcgacgaaccgcac
ggccaggccgacgagcacgcaaccgaagcggcatcggtacgtagccggtccaccgacggc
gaagcgctcgcgcgcttcgcgatcgatctgaccgacaaggcgcgtcgcggcgacatcgat
ccggtctttggccgcgaccgcgagatccagcagatggtcgacgtgctcgcgcgtcgacgc
aagaacaacccgatcctcgtcggtgaaccgggcgtcggcaagaccgcgctcgtcgaaggg
ctcgcgctgcgtgtcgccaacaaggacgtgccgaacgtgattcgcgacgttcggatcctg
acgctcgatctcggcctgctgcaggccggcgccggcgtgaagggcgaattcgagcagcgc
ctgaagaacgtgatcgacgaggtgcaagcgtcgccggagccgattctgctgttcatcgac
gaagcccatacgttgatcggcgccggcaacgccgccggcggcgccgatgcggccaacctg
ctgaagccggccctcgcgcgcggcgaactgcgcaccatcgccgcgaccacgtggtccgaa
tacaagcagttcttcgagcgcgacgccgcgctcgagcgacgctttcagatcatcaaggtc
gacgagcccgacgacgatgccgcctgcctgatgctgcgcgggctgaagaaccactacgcg
aaataccatcacgtccacatccgcgacgaagcgctcgtggccgcggtcaagctctcgcgc
cgctacatccccgctcggcagctgccggacaaggcggtcgacctgatcgatacggcggcc
gcgcgcgtgcgcatggggctcgaaacgccgcccgccgaactgcagcgcgcacgcgcggcg
gtgtcggcgctcgagctggagcagacgacgctcgacgccgatgcgcaggccgggatcgac
ggcatcgagaaccggcgcgaagtgctggcgcgcgcgctgagcgacgcgcgcaatgcgctc
acgctgttgcagacgcgctataccaccgaactcgaactggttcagctggtgcatgagcag
cgcgcggcgaaagaaaacgcagaggccgtcgccgaactcggatcgctcgacgacgcgcag
cagctcctcgccgatgtgcagggcaaagcaccgctagtgttcgtggacgtcgatgcggcg
gccattgcgcgcgtcgtcgccgaatggaccggcgtgccggtcggcagcctcgtggaggac
gagctgcagagcttgctgacgctcgaacggcaactggccacgcgggtcgtcgcgcaggac
gatgctctcggcgcgctcgccgagagcttgcggaccgccaaggccggcctcaagaacgag
aacgcgccgctcggcgtcttcctgctcgccggcccgtcgggtgtcggcaagaccgaaacc
gcgctggcgctggccgacctgctgttcggcggggaggccgcgctcacgacgatcaacatg
tcggagtatcaggaagcgcatacggtgtcgcagctgaagggctcgccgcccggctacgtc
ggctacggccgcggcggcgtcctgaccgaagccgtgcggcaacggccgtacagcgtcgtg
ctgctcgacgaggtcgaaaaggcgcatcgcgacgtgctcgacatgttctatcaggtgttc
gaccgcggcacgatgcgcgacggcgaaggacgcgagatcgacttccgcaattgcgtgatc
ctgatgacgtccaatctcggcagcgcgcagatcgacgacgccaccgccgacgatccgcac
atcacgcaggcggcgctgctcgacgcgattcatccgcagctcgtcgcgcacttccagccc
gcgttgctcgcacgcttccagtcgctcgtctaccggccgctcgatgccgccgcgctgtcg
tcgatcgtgcggctgaagctcgcgaaggtggccgagcgcctgcgccggcaacacgacgtc
gaactgtcctgcgacgacgcgctgatcggctcgatggccgagctttgtctcgctcgcgaa
tccggcgcgcgcaacgtcgacgcgttccttaatcaacgcattctgccgaccgtgtcgcgc
gagctgctcgcgcgcatggccgccggcgacatgccggcgaagatcgtcctgtcgagctcg
gccgacggcaacctgacgatcgatttcgtcgcccgggacgccgtcgcggccggcccgagc
gagccggcatcggccgccgcgtga

DBGET integrated database retrieval system