KEGG   Burkholderia sp. 2002721687: BW21_1293Help
Entry
BW21_1293         CDS       T03759                                 

Definition
(GenBank) dihydrofolate reductase family protein
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
bul  Burkholderia sp. 2002721687
Pathway
bul00670  One carbon pool by folate
bul00790  Folate biosynthesis
bul01100  Metabolic pathways
Module
bul_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bul00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BW21_1293
   00670 One carbon pool by folate
    BW21_1293
Enzymes [BR:bul01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BW21_1293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AJY42522
UniProt: A0A0D5LF72
Position
I:complement(1394421..1394924)
Genome map
AA seq 167 aa AA seqDB search
MTTLTLIVARARNGVIGRDNQLPWKLPEDLAFFKRTTMGAPIVMGRRTHESIGRPLPGRR
NIVVTRDAARRFDGCDTVTSLDGALALAARDGAAEAFLIGGAQLYAEGLRHADKLIVTEI
DQDFEGDASFPAPDPAQWEAVSRDAHRAAAPNDFAYAFVVYRRKRAG
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgctgaccctgatcgtcgcgcgcgcccgcaatggcgtgatcggccgcgacaac
caacttccgtggaaacttcccgaggacctcgcattcttcaagcgcacgacgatgggcgcg
ccgatcgtgatgggccgcaggacgcacgaatcgatcggccggccgctgcccggccgccgc
aacatcgtcgtcacgcgcgacgccgcgcgacgcttcgacggctgcgacacggtcacgtcg
ctcgacggcgcgctcgcgctcgccgcgcgcgacggcgcggccgaagcgttcctgatcggc
ggcgcgcagttgtacgcggagggcctgcgccacgcggacaagctgatcgtcaccgagatc
gatcaggatttcgaaggcgacgcgtcgtttcccgcgcccgatcccgcgcaatgggaagcc
gtgtcgcgcgatgcgcatcgcgcggccgcgccgaacgacttcgcatatgcattcgtcgtc
tatcgtcgcaagcgcgccggttga

DBGET integrated database retrieval system