KEGG   Burkholderia sp. 2002721687: BW21_1318Help
Entry
BW21_1318         CDS       T03759                                 

Definition
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain protein
  KO
K00090  glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
bul  Burkholderia sp. 2002721687
Pathway
bul00030  Pentose phosphate pathway
bul00260  Glycine, serine and threonine metabolism
bul00620  Pyruvate metabolism
bul00630  Glyoxylate and dicarboxylate metabolism
bul01100  Metabolic pathways
bul01110  Biosynthesis of secondary metabolites
bul01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BW21_1318
   00620 Pyruvate metabolism
    BW21_1318
   00630 Glyoxylate and dicarboxylate metabolism
    BW21_1318
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BW21_1318
Enzymes [BR:bul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     BW21_1318
    1.1.1.81  hydroxypyruvate reductase
     BW21_1318
    1.1.1.215  gluconate 2-dehydrogenase
     BW21_1318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored IlvN Legionella_OMP TrkA_N
Motif
Other DBs
NCBI-ProteinID: AJY42209
UniProt: A0A0D5LEW9
Position
I:1419085..1420074
Genome map
AA seq 329 aa AA seqDB search
MQKILVARSIFPDVIERLKQYFDVDWNDGDALAPDVLKARLADKDGALTAGDMIDASVLA
AAPRLRVVSNMAVGYNNFDIGAFNAAHVLGTNTPDVLTETTADFGWALMMAAARRIAESE
HWLRAGQWRKWSYDSFLGADIHGATLGVIGMGRIGQALARRARGFAMRVIYHNRSRVAPE
IEAELGAEYVSKAALLAQADHVVLVLPYSAESHHTIGAAELALMKPTATLTNIARGGIVD
DAALADALRDKRIAAAGLDVFEGEPSVHPALLDVPNVVLTPHIASASEGTRRAMANLAAD
NLIAALGAGPRAGRPPNPINPGVLGKARI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaaatcctggtcgcgcgctcgatctttccggacgtgatcgagcggctcaagcag
tatttcgacgtcgactggaacgacggcgacgcgcttgcccccgacgtgctgaaggcgcgc
ctcgcggacaaggacggcgcgctgacggcgggcgacatgatcgacgcgtcggtgctcgcg
gccgcgccgcggctgcgcgtcgtgtcgaacatggcggtgggctacaacaacttcgacatc
ggtgcgttcaacgccgcgcacgtgctcggcaccaacacgcccgacgtgctgaccgagacg
acggccgacttcggctgggcgctgatgatggcggccgcgcggcggattgccgaatccgag
cactggctgcgcgcggggcaatggcgcaagtggtcgtacgacagcttcctcggcgcggac
attcacggcgcgacgctcggcgtgatcggcatgggccgcatcggccaggcgctcgcgcgt
cgcgcgcgcggcttcgccatgcgcgtgatctatcacaaccgctcgcgcgtcgcgcccgag
atcgaggccgagctgggcgcggagtacgtgtcgaaggcggcgctcctcgcgcaggccgat
cacgtcgtgctcgtgctgccgtactcggcggaaagccaccatacgatcggagcggccgag
ctcgcgctgatgaagccgaccgcgacgctcacgaacatcgcgcgcggcgggatcgtcgac
gacgcggcgctcgccgacgcgctgcgcgacaagcggatcgcggcggccggcctcgacgtg
ttcgaaggcgagccgagcgtgcatccggcgctgctcgacgtgccgaacgtcgtgctgacg
ccgcacatcgcgagcgcgagcgaaggcacgcgtcgcgcgatggcgaatctcgcggcggac
aacctgatcgcggcgctcggcgccgggccgcgcgcggggcgtccgccgaatccgatcaat
cccggcgtgctggggaaggctcgcatatga

DBGET integrated database retrieval system