KEGG   Burkholderia sp. 2002721687: BW21_1520Help
Entry
BW21_1520         CDS       T03759                                 

Definition
(GenBank) PHP domain protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
bul  Burkholderia sp. 2002721687
Brite
KEGG Orthology (KO) [BR:bul00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BW21_1520
Enzymes [BR:bul01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     BW21_1520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP NIR_SIR_ferr DUF442
Motif
Other DBs
NCBI-ProteinID: AJY43885
UniProt: A0A0D5LKZ8
Position
I:1647976..1648806
Genome map
AA seq 276 aa AA seqDB search
MNADLHCHSNVSDGQLAPADVARRAHAGGVTLWALTDHDEVGGQRAAREAAEALGMRYLH
GVEISVTWASRTVHIVGLNIDPQNPALVDGLRRTRNGRAARAVAIGDALAALGIEGAYEG
ALGFVSNPDLISRTHFARFLVDKGYAASISDVFDRYLGEGKPGYVAHRWAKLSDAVTWIR
QAGGEAVIAHPGRYAYTSVEFDAFFGEFIDLGGVAIEVVTGSHTPDQYREYADVARRFGF
EASRGSDFHAPGEGRTELGSLPPLPSDLKPVWERWL
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgatctccactgccattcgaacgtttccgacggtcagctcgcgcccgccgac
gtcgcgcgccgcgcgcacgcgggcggcgtcacgctgtgggcgctgaccgatcacgacgag
gtcggcggccagcgcgccgcgcgtgaagccgccgaggcgctcggcatgcgctatctgcac
ggcgtcgagatttccgtgacgtgggcgtcgcgcaccgtgcacatcgtcggcctgaacatc
gatccgcagaaccccgcgctcgtcgacgggctccgccgcacccgcaacggccgcgcggcg
cgcgcggtcgcgatcggcgacgcgctcgccgcgctcggcatcgagggggcctacgaaggc
gcgctcggctttgtgtcgaatcccgatctgatctcgcgcacccacttcgcgcgctttctc
gtcgacaagggctacgcggcgtcgatatccgacgtgttcgaccgctatctcggcgaaggc
aagccgggctacgtcgcgcaccgctgggcgaagctgtcggacgccgtcacgtggatccgg
caggcgggcggcgaagcggtcatcgcgcatccgggccgctatgcgtacacgagcgtcgag
ttcgacgcgttcttcggcgagttcatcgatctgggcggcgtcgcgatcgaggtcgtgacg
ggcagccacacgcccgaccagtaccgcgaatacgcggacgtcgcgcggcgcttcggcttc
gaggcgtcgcgcggctccgattttcacgcgccgggagaagggcgcaccgagctcggcagc
ctgccgccgctgccgtccgatctcaaacccgtctgggagcgctggctgtag

DBGET integrated database retrieval system