KEGG   Burkholderia sp. 2002721687: BW21_1577Help
Entry
BW21_1577         CDS       T03759                                 

Gene name
dehII
Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
bul  Burkholderia sp. 2002721687
Pathway
bul00361  Chlorocyclohexane and chlorobenzene degradation
bul00625  Chloroalkane and chloroalkene degradation
bul01100  Metabolic pathways
bul01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bul00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BW21_1577 (dehII)
   00361 Chlorocyclohexane and chlorobenzene degradation
    BW21_1577 (dehII)
Enzymes [BR:bul01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     BW21_1577 (dehII)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2
Motif
Other DBs
NCBI-ProteinID: AJY41399
UniProt: A0A0D5LCL3
Position
I:complement(1705616..1706371)
Genome map
AA seq 251 aa AA seqDB search
MPGTPPAFPKAILFDAYGTLFDVHAVVAAAEQMFPGRGEALSQLWRRKQIEYSQLRTLAD
PAGARYRPFWDLTLDGLRFAARALGLALPAAAEKRLMDEYACLSTYPDTVPTLRALRARS
APPKLAILSNGNPQMLDIAVKSAGMSGLFDRVLSVDAARAYKPSPAAYALGTAAFDAAAT
DIAFVSSNGWDVAGAGWFGYRTFWLNRTGAPLEELGAAPSGMGAGMAELLAFLDAPPAAA
KAAGRTRPAPA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcaccccgcccgccttcccgaaggcgattcttttcgacgcgtacggcacgctg
ttcgacgtgcacgcggtcgtcgccgcggccgagcagatgtttccggggcgcggcgaggcg
ctgtcgcagctctggcggcgcaaacagatcgaatactcgcaactgcgcacgctcgccgat
ccggcaggcgcgcgctatcggccgttctgggacctgacgctcgacgggctgcgctttgcc
gcgcgtgcgctcggcctcgcgctgcccgccgcggccgagaagcggctgatggacgaatac
gcgtgcctgtcgacgtatccggacacggtgccgacgctgcgcgcattacgcgcgcgcagc
gcgccgccgaagctcgcgatcctgtcgaacggcaatccgcagatgctcgacatcgcggtc
aagagcgccgggatgagcggcctcttcgatcgcgtgctgtccgtcgacgcggctcgcgcg
tacaaaccgtcgcccgccgcgtatgcgctcggcacggcggcgttcgatgcggccgcgacc
gacatcgcgttcgtgtcgtcgaacggctgggacgtcgcgggcgccggctggttcggctac
cggaccttctggctgaaccgcacgggcgcgccgctcgaggagctcggcgcagcgccctcg
ggcatgggcgccgggatggccgagctgctcgcctttctcgacgcgccgcccgccgccgcg
aaagcggccggccgcacgcgcccggcgcccgcctga

DBGET integrated database retrieval system