KEGG   Burkholderia sp. 2002721687: BW21_1992Help
Entry
BW21_1992         CDS       T03759                                 

Definition
(GenBank) 3-beta hydroxysteroid dehydrogenase/isomerase family protein
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
bul  Burkholderia sp. 2002721687
Pathway
bul00520  Amino sugar and nucleotide sugar metabolism
bul01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BW21_1992
Enzymes [BR:bul01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     BW21_1992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind adh_short KR
Motif
Other DBs
NCBI-ProteinID: AJY41341
UniProt: A0A0D5LB57
Position
I:2184197..2185159
Genome map
AA seq 320 aa AA seqDB search
MDNGRRKRILVTGGAGFLGSHLCERLLSDGHEVLCVDNFYTGTKDNVAHLLANPYFEIMR
HDVTFSLYVEVDEIYNLACPASPIHYQFDPVQTTKTSVHGAINMLGLAKRVKAKIFQAST
SEVYGDPEVHPQREEYWGNVNAIGFRSCYDEGKRCAETLFFDYHRQHNLRIKVARIFNTY
GPRMHPSDGRVVSNFIVQALKNEPITLYGDGTQTRSFCYVSDLIEAFTRFMQCPDQVTGP
MNMGNPEEFTIRTLAETVIELTGSRSRMTFLPLPPDDPKQRRPDITLAREFLHWTPTTPL
EHGLKLTIDYFDRLLGHGRG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtggataacgggcgtagaaaacggatcctggtcaccggcggagcgggctttcttggatcg
cacctctgtgaacggctgttgtcggatggccatgaggtactttgcgtcgacaacttttat
accggcaccaaggacaacgttgcccatctcctggccaatccttatttcgagatcatgcgc
cacgatgtcacattctcgctctacgtcgaagtagacgaaatctacaacctggcgtgccct
gcgtcgcctatccactatcaattcgatcccgtgcagaccaccaagacgagcgtgcacggg
gccatcaacatgcttggactcgccaagcgggtcaaagccaagatatttcaggcgtccacc
agtgaagtctatggagaccccgaggttcatcctcagcgcgaggagtattggggaaacgtc
aatgcgatcggcttccgatcctgttacgacgaaggcaagcgttgtgcagaaaccctcttc
ttcgattaccaccggcagcataatctgcgtatcaaggtcgcgcgcattttcaatacctat
ggtccgcgcatgcacccgtcggatggccgcgtggtgtccaatttcatcgtccaggcgttg
aagaacgagcccatcaccctatacggcgatggtactcagacacgatcgttctgctacgtg
agcgatttgattgaagcctttacgcgtttcatgcaatgcccggatcaggtcacaggtccc
atgaacatggggaacccggaggagttcaccatccgcacactggcggagacggtgatcgag
ctgacgggttcccgctcaagaatgaccttcctcccgctgccccctgacgatccgaaacaa
cgcaggccggatatcacattggcgcgagagtttctgcactggacgccgacaacgccactg
gagcatggcctcaaactgacgattgactatttcgatcggttgcttggtcacgggcgagga
tga

DBGET integrated database retrieval system