KEGG   Burkholderia sp. 2002721687: BW21_245Help
Entry
BW21_245          CDS       T03759                                 

Definition
(GenBank) delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
bul  Burkholderia sp. 2002721687
Pathway
bul00250  Alanine, aspartate and glutamate metabolism
bul00330  Arginine and proline metabolism
bul01100  Metabolic pathways
bul01110  Biosynthesis of secondary metabolites
bul01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bul00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BW21_245
   00330 Arginine and proline metabolism
    BW21_245
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bul03000]
    BW21_245
Enzymes [BR:bul01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     BW21_245
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     BW21_245
Transcription factors [BR:bul03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    BW21_245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: AJY42784
UniProt: A0A0D5LGL4
Position
I:262113..266042
Genome map
AA seq 1309 aa AA seqDB search
MASTTLGVKVDDLLRSRLKDAASRLERTPHWLIKQAIFAYLERIEHGQLPPELSGHTGAA
DLSDSHADGDEDGAPHPFLEFAQNVQPQSVLRAAITAAYRRPEPECVPFLIGEARLPASL
APDVQSMAAGLVEALREKSSGGGVEGLIHEFSLSSQEGVALMCLAEALLRIPDRATRDAL
IRDKISKGDWRSHVGHAPSLFVNAATWGLMITGKLVTTNSEAGLSSALTRLIGKGGEPLI
RKGVDMAMRLMGEQFVTGETISEALANSRKYEARGFRYSYDMLGEAATTEEDALRYYASY
EQAIHAIGKAAGGRGIYEGPGISIKLSALHARYSRSQQERTMVELLPRVRSLALLARRYD
IGLNIDAEEADRLELSLDLLEALCFDPELAGWNGIGFVVQAYQKRCPFVIDYLVDLARRS
RHRLMIRLVKGAYWDTEIKRAQVDGLEGYPVYTRKIYTDVSYLACAKKLLAAPDAVYPQF
ATHNAYTLAAIYHLAGQNYYPGQYEFQCLHGMGEPLYEEVTGRDKLNRPCRVYAPVGTHE
TLLAYLVRRLLENGANTSFVNRIADKTVSVKELVADPLDEAAKVVPLGAPHEKIPLPREL
YGASRVNSMGLDLSNEHRLASLSSALLASAHHPWRAAPMLADDALEHAAPRDVRNPADLR
DIVGTVSEATPEEVGAALAHAVAAAPIWQATPVDARADCLARAADLLEAQMHTLMGLIVR
EAGKSLPNAIAEIREAVDFLRYYSAQIRDEFSNDTHRPLGPVVCISPWNFPLAIFMGQVA
AALAAGNTVLAKPAEQTPLIAAQAVRLLRDAGVPAGAVQLLPGNGETVGAALVADSRTRA
VMFTGSTEVARLINKTLSSRLDPDGKPIPLIAETGGQNAMIVDSSALAEQVVADVLQSSF
DSAGQRCSALRVLCLQDDVADRTLTMLKGAMRELALGNPDRLSADVGPVIDADAKRTIDA
HIAAMKDKGHAVTQLAMPDACAQGTFVPPTIIEIGNVDELKREVFGPVLHVVRYRRSGLD
KLLEQIRATGYGLTLGIHTRIDETIAHVISHAHVGNIYVNRNVIGAVVGVQPFGGEGLSG
TGPKAGGALYLPRLLATRPAGLPRSLEASLVADAPQEGETRDNPSAALTALRDWLIEQRE
PALAARCDGYLSHVLAGATAVLSGPTGERNTYTLGARGTVLCIAATASGARAQFAAVLAT
GNRALFAGAAGEALAAALPASLKAQAGVRKQADAAFDAVLFEGDSDELLALVKEVAQRPG
PIVSVQGVAAGAFENGGDEDYALERLLTERSVSVNTAAAGGNANLMTIG
NT seq 3930 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcaccacactgggcgtcaaagtcgacgatctgctccgctcgcgtctgaaggac
gcggcgtcgcggctcgagcgcactcctcactggctgatcaagcaggcgatcttcgcgtat
ctcgagcggatcgagcacggtcagcttccgccggagctgtccggccacacgggcgccgcc
gacctgtccgacagccacgccgacggcgacgaagacggcgcgccgcacccgttcctcgaa
ttcgcgcagaacgtgcagccgcaatcggtgctgcgcgcagcgatcacggccgcgtaccgc
cgcccggagcccgagtgcgtgccgttcctgatcggcgaggcgcggctgcccgcgagcctg
gcgccggatgtccagtcgatggcggcgggcctcgtcgaggcgctgcgcgagaagagctcg
ggcggcggcgtcgagggactgatccacgaattctcgctgtcgagccaggaaggcgtcgcg
ctgatgtgcctcgccgaggcgctgctgcggattcccgaccgcgcgacccgcgatgcgctg
atccgcgacaagatcagcaagggcgactggcgctcgcacgtcggccacgcgccgtcgctg
ttcgtcaacgcggccacctggggcctgatgatcacgggcaagctcgtcacgacgaacagc
gaagcgggcctgtcgtcggcgctcacgcggctgatcggcaagggcggcgagccgctcatc
aggaagggcgtcgacatggcgatgcgcctgatgggcgagcagttcgtcacgggcgagacg
atctccgaagcgctcgcgaacagccgcaagtacgaggcgcgcggcttccgctactcgtac
gacatgctcggcgaggcggcgacgaccgaagaggacgcgctgcgctactacgcgtcgtac
gagcaggcgatccacgcgatcggcaaggcggcgggcggccgcggcatctacgaaggcccg
ggcatctcgatcaagctgtcggcgctgcacgcgcgctactcgcgctcgcagcaggaacgc
acgatggtcgagctgctgccgcgcgtgcgctcgctcgcgctgctcgcgcgccgctacgac
atcggcctgaacatcgatgccgaggaggcggaccggctcgagctgtcgctcgatctgctc
gaggcgctgtgcttcgatccggagctcgccggctggaacggcatcggcttcgtcgtgcag
gcgtaccagaagcgctgcccgttcgtgatcgactacctcgtcgacctcgcgcgccgcagc
cgccatcgcctgatgatccgcctcgtgaagggcgcgtactgggataccgagatcaagcgc
gcgcaagtggacggcctcgaaggctatccggtctacacgcgcaagatctacacggacgtg
tcgtacctcgcgtgcgcgaagaagctgctcgccgcgcccgacgccgtctatccgcagttc
gcgacgcacaatgcttacacgctcgccgcgatctatcacctcgcgggccagaactactac
cccggccagtacgaattccagtgcctgcacgggatgggcgagccgctgtacgaggaagtt
accggccgcgacaagctgaaccgcccgtgccgcgtgtatgcgcccgtcggcacgcacgag
acgctgctcgcgtacctcgtgcgccgcctgctggaaaacggcgcgaacacgtcgttcgtg
aaccgcattgccgacaagaccgtgtcggtgaaggagctggtcgccgatccgctcgacgaa
gccgcgaaggtcgtgccgctcggcgcgccgcacgagaagatcccgctgccgcgcgagctg
tacggcgcgtcgcgcgtcaattcgatgggcctcgatctgtcgaacgagcaccggctcgcg
tcgctgtcgtcggcgctgctcgcgagcgcgcatcatccgtggcgcgccgcgccgatgctc
gccgacgacgcgctcgagcacgccgcgccgcgcgacgtgcgcaatccggccgatctgcgc
gacatcgtcggcacggtcagcgaggcgacgcccgaagaggtgggcgcggcgctcgcgcac
gcggtcgcggccgcgccgatctggcaggcgacgcccgtcgacgcgcgcgccgattgcctc
gcacgcgcggcggatcttctcgaagcgcagatgcacacgctgatgggcctgatcgtgcgc
gaggcgggcaagtcgctaccgaacgcgatcgccgagatccgcgaggcggtcgatttcctg
cgctactactcggcgcagatccgcgacgagttctcgaacgacacgcatcgcccgctcggc
cccgtcgtctgcatcagcccgtggaacttcccgctcgcgatcttcatgggccaggtggcg
gccgcgctcgcggcgggcaacacggtgctcgcgaagccggccgagcagacgcccctcatc
gccgcgcaggcggtgcgcctgctgcgcgacgccggcgtgccggcgggcgcggtgcaactg
ctgccgggcaacggcgagacggtcggcgcggcgctcgtggcggactcccgcacgcgcgcg
gtgatgttcaccggctcgaccgaagttgcgcgcctcatcaacaagacgctgtcgtcgcgc
ctcgatccggacggcaagccgatcccgctgatcgccgagacgggcggccagaacgcgatg
atcgtcgattcgtcggcgctcgccgagcaggtcgtcgccgacgtgctgcagtcgtcgttc
gactcggccggtcaacgctgttcggcgctgcgcgttctgtgtctgcaggacgacgtcgcg
gaccgcacgctgacgatgctcaagggcgcgatgcgcgagctcgcgctcggcaatccggac
cggctgtcggcggacgtcgggccggtgatcgacgccgacgcgaagcgcacgatcgacgcg
cacatcgcggcgatgaaggacaaggggcacgcggttacgcagctcgcgatgccggacgcg
tgcgcgcaaggcacgttcgtgccgccgacgatcatcgagatcggcaacgtcgacgagctc
aagcgcgaagtgttcggcccggtgctgcacgtcgtgcgctatcgccgcagcggcctcgac
aagctgctcgagcagatccgcgcgacgggctacggcttgacgctcggcatccacacgcgg
atcgacgagacgatcgcgcacgtgatctcgcacgcgcacgtcggcaacatctacgtgaac
cgcaacgtgatcggcgcggtggtcggcgtgcagccgttcggcggcgaagggctgtcgggc
acggggccgaaggcgggcggcgcgctctatctgccgcgcctgctcgcgacgcgcccggcc
gggctgccgcgctcgctcgaggcgtcgctcgtcgccgacgcgccgcaggaaggcgagacg
cgcgataatccgtccgccgcgctgaccgcgctgcgcgactggctgatcgagcagcgcgag
ccggcgcttgccgcgcgctgcgacggctacctgtcgcacgtgctcgcgggcgcaaccgcc
gtgctctcggggccgacgggcgagcgcaatacgtatacgctcggcgcgcgcggcacggtg
ctgtgcatcgcggcgacggcgagcggcgcgcgcgcgcagttcgcggcggtgctcgccacg
ggcaaccgcgcgctcttcgcgggcgcggcgggcgaggcgctcgccgcggcgctgccggca
tcgctgaaggcgcaggcgggcgtgaggaagcaggcggacgcggcgttcgacgcggtgctg
ttcgaaggcgacagcgacgagctgctcgcgctcgtgaaggaagtcgcgcagcgcccggga
ccgatcgtgtcggtgcagggcgtcgcggcgggcgcgttcgagaacggcggcgacgaggac
tacgcgctcgagcggctcctcaccgagcgctcggtgagcgtgaacaccgcggcggcaggc
ggcaatgcgaatttgatgacgattggctga

DBGET integrated database retrieval system