KEGG   Burkholderia sp. 2002721687: BW21_3182Help
Entry
BW21_3182         CDS       T03759                                 

Gene name
sucD
Definition
(GenBank) succinate-CoA ligase, alpha subunit
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
bul  Burkholderia sp. 2002721687
Pathway
bul00020  Citrate cycle (TCA cycle)
bul00640  Propanoate metabolism
bul00660  C5-Branched dibasic acid metabolism
bul01100  Metabolic pathways
bul01110  Biosynthesis of secondary metabolites
bul01120  Microbial metabolism in diverse environments
bul01130  Biosynthesis of antibiotics
bul01200  Carbon metabolism
Module
bul_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bul_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BW21_3182 (sucD)
   00640 Propanoate metabolism
    BW21_3182 (sucD)
   00660 C5-Branched dibasic acid metabolism
    BW21_3182 (sucD)
Enzymes [BR:bul01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BW21_3182 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig DUF1611_N
Motif
Other DBs
NCBI-ProteinID: AJY43721
UniProt: A0A0D5LHW8
Position
I:complement(3531470..3532351)
Genome map
AA seq 293 aa AA seqDB search
MSILINKDTKVITQGITGKTGQFHTRACREYANGREAFVAGVNPKRAGEDFEGIPIYASV
KEAKAETGATVSVIYVPPAGAAAAIWEAVEADLDLAICITEGIPVRDMIEVKDRMRREGR
KTLLLGPNCPGTITPDELKIGIMPGHIHRKGRIGVVSRSGTLTYEAVAQLTALGLGQSSA
VGIGGDPINGLKHIDVMKMFNDDPDTDAVVMIGEIGGPDEATAAQWIKDNMKKPVVGFIA
GVTAPPGKRMGHAGALISGGADTAEAKLEIMDACGIKVTRNPSEMGRLLKAAL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattctgatcaacaaagacacgaaggtcatcacgcagggcatcaccggcaagacc
ggccagttccacacgcgcgcctgccgtgagtacgcaaacggccgcgaagcgtttgtcgcg
ggcgtgaacccgaagcgcgccggcgaagatttcgaaggcattccgatctacgcgagcgtc
aaggaagcgaaggcggaaaccggcgcgaccgtgtcggtcatctacgtgccgcccgcgggc
gccgccgcggcgatctgggaagcggtcgaggccgatctcgatctcgcgatctgcatcacg
gaaggcattcccgtgcgcgacatgatcgaagtgaaggaccgcatgcgccgcgaaggccgc
aagacgctgctgctcgggccgaactgcccgggcacgatcacgccggacgagctgaagatc
ggcatcatgccgggccacatccaccgcaagggccgcatcggcgtcgtgtcgcgctcgggc
acgctgacttacgaagcggtcgcgcaactgacggcgcttggccttggccaatcgtcggcg
gtcggcatcggcggcgacccgatcaacggtctgaagcacatcgacgtgatgaagatgttc
aacgacgatccggatacggacgcagtcgtgatgatcggcgagatcggcggtccggacgaa
gcaacggcggctcagtggatcaaggacaacatgaagaagcctgtcgtcggcttcatcgcg
ggcgtcacggcgcctccgggcaagcgcatgggccacgccggcgcgctgatctcgggcggt
gcggacacggccgaagcgaagctggaaatcatggacgcgtgcggcatcaaggtcacgcgc
aatccgtcggaaatgggccgcctgctgaaggcggcgctgtaa

DBGET integrated database retrieval system