KEGG   Burkholderia sp. 2002721687: BW21_3511Help
Entry
BW21_3511         CDS       T03759                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bul  Burkholderia sp. 2002721687
Pathway
bul00071  Fatty acid degradation
bul00072  Synthesis and degradation of ketone bodies
bul00280  Valine, leucine and isoleucine degradation
bul00310  Lysine degradation
bul00362  Benzoate degradation
bul00380  Tryptophan metabolism
bul00620  Pyruvate metabolism
bul00630  Glyoxylate and dicarboxylate metabolism
bul00640  Propanoate metabolism
bul00650  Butanoate metabolism
bul00900  Terpenoid backbone biosynthesis
bul01100  Metabolic pathways
bul01110  Biosynthesis of secondary metabolites
bul01120  Microbial metabolism in diverse environments
bul01130  Biosynthesis of antibiotics
bul01200  Carbon metabolism
bul01212  Fatty acid metabolism
bul02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BW21_3511
   00630 Glyoxylate and dicarboxylate metabolism
    BW21_3511
   00640 Propanoate metabolism
    BW21_3511
   00650 Butanoate metabolism
    BW21_3511
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BW21_3511
   00072 Synthesis and degradation of ketone bodies
    BW21_3511
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BW21_3511
   00310 Lysine degradation
    BW21_3511
   00380 Tryptophan metabolism
    BW21_3511
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BW21_3511
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BW21_3511
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BW21_3511
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bul04147]
    BW21_3511
Enzymes [BR:bul01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BW21_3511
Exosome [BR:bul04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BW21_3511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJY43269
UniProt: A0A0D5LHZ8
Position
I:3907645..3908838
Genome map
AA seq 397 aa AA seqDB search
MTAVDQDPIVIASAARTPIAGFQGDFASLAAPQLGAAAIAAALERAGIKPEQIDEAVMGC
VLPAGQGQAPARQAALGAKLPLSVGCTTVNKMCGSGMRAAMFAHDMLVAGSVDVIVAGGM
ESMTNAPYLLPKARAGMRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEECAGEYAFTREA
QDAFAIESLARAKRANEDGSFAWEIAPVTVAGKKGDTVIARDEQPFKANPEKIPTLKPAF
SKTGTVTAANSSSISDGAAALVMMRASTANRLGLAPLARVVGHSTFAQAPSKFTTAPVGA
IRRLFDRNGWRAAEVDLYEINEAFAVVTMAAMKEHDLPHDKVNVNGGACALGHPIGASGA
RILVTLIGALRARGGKRGVASLCIGGGEATAMGIELI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacggctgttgatcaggacccgatcgtcatcgcgtcggcggcgcgcacgccgatcgcg
ggctttcagggcgacttcgcgtcgctcgccgcgccgcaactgggcgcggccgcgatcgcc
gcggcgctcgagcgcgcgggcatcaagcccgagcagatcgacgaagcggtgatgggctgc
gtgctgcccgcggggcagggacaggccccggcgcggcaggcggcgctcggcgcgaagctg
ccgctttcggtcggctgcacgacggtcaacaagatgtgcggctcgggcatgcgcgcggcg
atgttcgcgcacgacatgcttgtcgcgggctcggtcgacgtgatcgtcgcgggcggcatg
gaaagcatgacgaacgcgccgtacctgctgccgaaggcgcgcgcgggcatgcgcatgggc
cacggccaggtgctcgaccacatgttcctcgacggcctggaggacgcctacgacaagggc
cgcctgatgggcacgttcgccgaggaatgcgcgggcgaatacgcgttcacgcgggaggcg
caggacgcgttcgcgatcgaatcgctcgcgcgcgcgaagcgggcgaacgaggacggctcg
ttcgcgtgggaaatcgcgcccgtgacggtggccggcaagaagggcgacacggtgatcgcg
cgcgacgagcagccgttcaaggcgaaccccgagaagatcccgacgctcaagcccgcattc
agcaagacgggcaccgtgaccgccgcgaattcgtcgtcgatctccgacggcgcggccgcg
ctcgtgatgatgcgcgcgtcgacggcgaaccggctcgggctcgcgcccctcgcgcgcgtc
gtcggccattcgacgttcgcgcaagcgccgtcgaagttcacgacggcgcccgtcggcgcg
atccggcgcctgttcgacaggaacggctggcgcgcggccgaggtcgatctgtacgagatc
aacgaggcgttcgccgtcgtcacgatggcggcgatgaaggagcacgacctgccgcacgac
aaggtcaacgtgaacggcggcgcgtgcgcgctcggccatccgatcggcgcgtcgggcgcc
cgcatcctcgtcacgctgatcggcgcgctgcgcgcgcgcggcggcaagcgcggcgtcgcg
agcctgtgcatcggcggcggcgaggcgaccgcgatgggcatcgaactgatctga

DBGET integrated database retrieval system