KEGG   Burkholderia sp. 2002721687: BW21_4247Help
Entry
BW21_4247         CDS       T03759                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
bul  Burkholderia sp. 2002721687
Pathway
bul00040  Pentose and glucuronate interconversions
bul00053  Ascorbate and aldarate metabolism
bul01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BW21_4247
   00053 Ascorbate and aldarate metabolism
    BW21_4247
Enzymes [BR:bul01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     BW21_4247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AJY38390
UniProt: A0A0D5L5B8
Position
II:complement(754813..756393)
Genome map
AA seq 526 aa AA seqDB search
MQITGEMLIGSAAVRGTEGTMRACDPARGIELEPAFGAGGAGDVDRACRLANAAFDSFRQ
TPLETRARFLEAVAERIVGLGDRLIERAHAESALPVTRLEGELARTVGQLRLFASVVRDG
RWLNATLDSALPERKPVPRADLRLQKIPVGPVAVFGASNFPLAFSVAGGDTASAFAAGCP
VVAKAHPAHLGTSELVGRAIRQAVADCGLHEGVFSLVVGAGNAIGEALVAHPAIQAAGFT
GSRAGGIALMGIAARRREPIPVFAEMSSINPFFVLPGALRARGAKIAQGFVESLTLGVGQ
FCTNPGLVVALEGPDLKAFVDAAAQALAQKGAQTMLTSDIASSYESAVAARRAAAGVSEV
AQGARSDARNAALPTLFTTTQTQFVQDPQLEAEIFGPTSLVVACRDIGEMIALAEHVEGQ
LSATLHLEDDDVDLARKLLPTLERRAGRIVANGYPTGVEVAHAMVHGGPFPATSDSRSTS
VGALAIERFLRPVCYQDLPAALLPDALADANPLGLWRLRDGRLGQA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcactggggagatgttgattggctcggccgcggtgcgcggcaccgaaggcacg
atgcgcgcttgcgatccggcgcgaggtatcgagctcgagccggcgttcggcgcgggcggc
gcgggcgatgtcgaccgcgcgtgccgcctcgcgaacgccgcgttcgattcgtttcgccag
acgccgctcgagacgcgcgcgcgttttctcgaggcggtggccgagcgcatcgtagggctt
ggcgatcgattgatcgagcgcgcgcacgcggaatcggcgttgcccgtcacccgcctcgaa
ggcgagcttgcgcgcacggtcggccagctcaggctgttcgcgtcggtcgtgcgcgacggc
cgctggctgaatgcgacgctcgattccgcactgcccgagcgcaagccggtcccgcgcgcc
gatctgcgcttgcagaaaattccggtcggccccgtcgcggtgttcggcgcgagcaacttt
ccactcgcgttctcggtggcgggcggcgataccgcgtcggcgttcgcggccggctgcccg
gtcgtcgcgaaggcgcatcccgcgcatctcggcacgtcggaactcgtcggacgcgcgatc
cggcaggcggttgccgattgcggactgcacgaaggcgtgttctcgctcgtcgtcggcgca
ggcaacgcgatcggcgaggcgcttgtcgcgcatccggcgatccaggcggccggcttcacc
ggctcgcgcgcgggcggcatcgcgctgatgggcatcgccgcgcggcggcgcgagccgatt
ccggtcttcgcggaaatgagcagcatcaatccgttcttcgtgttgcccggcgcgttgcgc
gcgcgcggcgcgaagatcgcgcaaggcttcgtcgaatcgttgacgctcggcgtcgggcag
ttctgcacgaacccggggctcgtcgtcgcgctcgaagggcccgacctgaaggcgttcgtc
gatgcggccgcgcaggcgctcgcgcaaaagggcgcgcagacgatgctgacgtcggacatc
gcgtcgtcgtacgagagcgcggtcgcggcgcgtcgtgcggcggccggcgtcagcgaggtc
gcgcaaggcgcgcgcagcgacgcgcggaacgccgcgttgcccacgcttttcacgacgacg
cagacgcaattcgtccaggacccgcagctcgaagccgagatcttcgggccgacgtcgctc
gtcgtcgcgtgccgcgacatcggcgagatgatcgcgcttgccgagcacgtcgaagggcaa
ctgagcgcgacgctgcatctcgaagacgacgatgtcgatctggcgcgcaaactgctgccg
acgctcgagcgccgcgcgggccgcatcgtcgcgaacggctatccgacgggcgtcgaggtc
gcgcacgcgatggtgcacggcgggccgtttccggcgacgtcggattcgcgcagcacgtcg
gtcggcgcgctggcgatcgagcgcttcctgcggcccgtctgctatcaggacctgcccgcg
gcgctgctgcccgacgcgctcgccgacgcgaatccgctcggcctctggcgcctgcgcgac
ggccggctcggccaggcgtga

DBGET integrated database retrieval system