KEGG   Burkholderia sp. 2002721687: BW21_5053Help
Entry
BW21_5053         CDS       T03759                                 

Definition
(GenBank) hypothetical protein
  KO
K03332  fructan beta-fructosidase [EC:3.2.1.80]
Organism
bul  Burkholderia sp. 2002721687
Pathway
bul00051  Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:bul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BW21_5053
Enzymes [BR:bul01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.80  fructan beta-fructosidase
     BW21_5053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43 BNR_2 BNR
Motif
Other DBs
NCBI-ProteinID: AJY38607
UniProt: A0A0D5L3Y6
Position
II:complement(1689595..1691259)
Genome map
AA seq 554 aa AA seqDB search
MSIPRSRFSSLFSGFVALAACFGFVAHAAEAPCTPRSATSAPSADGTPQWRPALHYAPQR
NWMNDPNGLVYDDGVYHLFYQYNPHGNFWGDMSWGHATSRDLVHWDEQPVAMPANAREEI
FSGSIVVDARNTSGLGTADAPPLVALYTSVYKAGSGHAAGTQAQSLAYSVDHGKTWRPYA
RNPVLTLDPESRHFRDPKVTWYAPGGYWMMTTVVADAHVVKLYRSSDLIHWDFLSDFTLP
DVPHRGALWEMPELLPMPLDGDATRTKWVLIVNVNPWSIAGGSGAMYFVGGFDGRTFTPD
RAAPANADPAQYQWLDHGADYYAAGTFANAPGDRPVAIGWMSNWDYADRIPTTPWKGTMA
LPRELALKTIDGRPQLTVVPARPFDAFARGLPAVRIGSLAVASATRELDAGARGTVQRIA
LTIEPRSARRAGLIVRRSADGRVGTRIAYDTAARTLTVDRSASGETNFSSAFSKQHIVAL
PLVNGKLRLDVIVDRGSVEVFDGDGRTVITDLVFPSPADDRVAVFAEGGDATFSDVVVTN
LGAAAGMRRACSKS
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcccccgatcacgtttttcttccctcttctccggcttcgtcgcgctcgccgcg
tgcttcggcttcgtcgcgcatgctgcggaggcgccatgcacgccgcggtccgcgacatcc
gcaccgtccgccgacggcacgccgcaatggcgccccgcgctgcactacgcgccgcagcgc
aactggatgaacgacccgaacggcctcgtctacgacgacggcgtctatcacctgttctat
caatacaatccgcacggcaacttctggggcgacatgtcgtgggggcacgcgacgagccgc
gatctcgtgcactgggacgagcagccggtcgcgatgccggcgaacgcgcgcgaggagatt
ttctccggctcgatcgtcgtcgatgcgcgcaacacgtcgggcctcggcaccgcggatgcg
ccgccgctcgtcgcgctctacacgagcgtctacaaggcgggctccggccacgcagccggc
acgcaggcgcagtcgctcgcgtacagcgtcgatcacggcaagacatggcggccgtacgca
cgcaatccggtcctcacgctcgatcccgaatcgcggcatttccgcgacccgaaagtgacg
tggtacgcgccgggcggctactggatgatgacgacggtcgtcgccgacgcgcacgtcgtc
aagctgtatcggtcgagcgacctgattcactgggatttcctgagcgacttcacgctgccc
gacgtcccgcatcgcggcgcgctgtgggaaatgcccgagctgctgccgatgccgctcgac
ggcgacgcgacgcgcacgaaatgggtgttgatcgtcaacgtcaatccgtggtcgatcgcg
ggcggctcgggcgcgatgtatttcgtcggcggcttcgacggcaggacgttcacgcccgat
cgcgccgcgccggcgaacgccgatcccgcgcaataccaatggctcgaccacggcgccgat
tactacgcggccggcacgttcgcgaacgcgccgggcgaccggccggtcgcgatcggatgg
atgagcaattgggactatgcggaccgcattccgacgacgccgtggaaaggcacgatggcg
ttgccgcgcgagctcgcgctgaagacgatcgatggccggccgcagttgacggtcgtgccc
gcgcggccgttcgacgctttcgcccgcggcctgcctgccgtgcgtatcggctcgctcgcg
gtcgcgtcggcgacgcgcgagctcgacgccggcgcacgcggcaccgtgcagcgcatcgcg
ctgacgatcgagccgcggtcggcgcggcgcgccggcttgatcgtgcggcgctcggcagac
ggccgcgtcggtacgcgtatcgcctatgacacggcggcgcgcacgctgaccgtcgatcgc
tcggcgtccggcgaaacgaacttctcgagcgcgttcagcaagcaacacatcgtcgcgctg
ccgctcgtgaacggcaagctgcggctcgacgtgatcgtcgatcgcggttccgtcgaagtg
ttcgacggcgacggccggaccgtcatcaccgatctcgtgtttccgtcgccggcagacgac
cgggtcgccgtgttcgccgaaggcggcgatgcgacgttcagcgatgtcgtggtgacgaat
ctcggcgcggccgcgggcatgcggcgagcgtgctcgaaatcatag

DBGET integrated database retrieval system