KEGG   Burkholderia sp. 2002721687: BW21_5284Help
Entry
BW21_5284         CDS       T03759                                 

Definition
(GenBank) SMP-30/Gluconolaconase/LRE-like region family protein
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
bul  Burkholderia sp. 2002721687
Pathway
bul00053  Ascorbate and aldarate metabolism
bul01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    BW21_5284
Enzymes [BR:bul01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     BW21_5284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL PD40 NHL Str_synth
Motif
Other DBs
NCBI-ProteinID: AJY40631
UniProt: A0A0D5L933
Position
II:1960039..1960974
Genome map
AA seq 311 aa AA seqDB search
MESSNRPARTDAAAAATLLVDCRNALGEGATWCDATRALYWVDIEGARLWRWRAAGAYGG
AATDSWEMPERIACFALTDDPDVLLVGLASRIAFFDTRRRALAPVVDVEPELPTRVNDGR
CDRAGAFVFGMKDEGGGASPRAVGGYYRLNADLSLQRLALPPAAIANGIAFSPDGSAMYF
CDSPTREIQVCDYRPGGGVDRVRSFVRLADADGEPDGSTVDASGGVWNAQWGGARVVRYD
AQGVETDRIAVPTPQPSCVALDGDGRLYVTSARVGLDGGALARDPGAGGVFVAGTRHAGI
ATPRFALARNA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggaatcatcgaatcgaccggcgcgaacggatgcggcagccgccgcgacgctgctggtc
gactgccgcaacgcgctgggcgaaggcgcgacgtggtgcgacgcgacgcgcgcgctgtac
tgggtcgacatcgaaggcgcgcgcctgtggcgatggcgcgcggccggcgcgtacggcggc
gcggcgacggacagttgggagatgcccgagcgcatcgcatgcttcgcgctcaccgacgat
cccgatgtgctgctcgtcggccttgcgtcgcgcatcgcgttcttcgacacgcgccggcgg
gcgctcgcgccggtcgtcgacgtcgagcccgagctgccgacgcgcgtcaacgacggccgc
tgcgaccgcgcgggcgccttcgtgttcgggatgaaggacgagggcggtggcgcgtcgccg
cgcgcggtgggcggctattaccggctgaacgcggatttgagcctgcagcggcttgcgctg
ccgcccgccgcgatcgcgaacggcatcgcattttctccggacggctcggcgatgtatttc
tgcgattcgccgacgcgggaaatccaggtgtgcgactaccggccgggcggcggcgtcgat
cgcgtccggtcgttcgtccggcttgccgacgcggacggcgagcccgacggctcgacggtc
gatgcaagtggcggcgtgtggaacgcgcagtggggcggcgcgcgggtcgtgcgctacgac
gcgcaaggcgtcgagaccgatcgcatcgcggtgccgacgccgcagccgagctgcgtggcg
ctcgacggcgacgggcggctatacgtgacgagcgcgcgcgtcggcctcgacggcggcgcg
ctcgcgcgcgatccgggcgcgggcggcgtgttcgtcgccggtacgcgccatgcgggaatc
gcgacgccgcggttcgcgctcgcgcgcaacgcatga

DBGET integrated database retrieval system