KEGG   Burkholderia sp. 2002721687: BW21_6351Help
Entry
BW21_6351         CDS       T03759                                 

Definition
(GenBank) SMP-30/Gluconolaconase/LRE-like region family protein
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
bul  Burkholderia sp. 2002721687
Pathway
bul00053  Ascorbate and aldarate metabolism
bul01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    BW21_6351
Enzymes [BR:bul01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     BW21_6351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL Phytase-like PD40
Motif
Other DBs
NCBI-ProteinID: AJY38301
UniProt: A0A0D5L2K0
Position
pBTU:complement(244157..245125)
Genome map
AA seq 322 aa AA seqDB search
MQHQIQAARATLLVDGRNTLGEGATWCDATGTLYWVDIEGAQLWRCRADGTGATHWPMPE
RLACFALTDEPDVLLVGLATHLAFFDLRTETFTRIVDVEPGQPTRLNDGRCDPHGAFVFR
MKDEDGEPPRAVGGFYRLDADLTLERLVLPPATIANSIAFSPDGSKMYFCDSLVREILVC
DYGRAGTSRVRSFARLTDADGDPDGSTIDRDGGLWNAQWGGRRVVRYGPDGVETERIAVP
TAQPNCAALDDAGRLYVTSARVGLSDAALANDAHAGGVFVAQTRYAARRPRGSRSSARCA
ADRESRASRAGKMARNFIRPAS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatcagattcaggcggcacgggcgacgctgttggtggacggccgcaacacgctc
ggcgagggcgcgacgtggtgcgatgcgaccggcacgctgtactgggtcgacatagaaggc
gcgcagctttggcgatgccgcgccgacggcacgggtgcgacgcactggccgatgcccgag
cggctcgcgtgcttcgcgctgacggacgagccggacgtgctgctcgtcgggctcgcgacg
catctcgcgttcttcgacttgcgcacggagacgttcacgcggatcgtcgacgtcgagccc
ggccagccgacacggctcaacgacggccgctgcgatccgcacggcgcgttcgtgttccgg
atgaaggacgaagacggtgagccgccgcgcgcggtcggcgggttctaccggctcgatgcc
gacctcacactcgaacggctcgtgttgccgccggcgacgatcgcgaacagcatcgcgttc
tcgccggacggttcgaagatgtacttctgcgattcgctcgtgcgcgaaatcctcgtttgc
gactacggccgcgccggcacgtcccgcgtgcggtcgttcgcgcgcctgactgatgcggac
ggcgacccggacggctcgacgatcgatcgcgacggcgggctgtggaacgcgcaatggggc
ggaaggcgggtggtgcgctacgggccggacggtgtcgaaacggagcgcatcgccgtgccg
accgcgcagccgaactgcgcggcgctcgacgatgcagggcgcctgtacgtgacgagcgcg
cgcgtcgggctgagcgatgccgcgcttgcgaatgacgcgcacgccggcggcgtgttcgtt
gcgcagacgcgatacgcggctcgccgaccgcgcggttcccgttcaagcgcacggtgcgcg
gctgaccgcgagagccgcgcatcgcgtgctggtaagatggcccgcaatttcatccggccc
gcgtcatga

DBGET integrated database retrieval system