KEGG   Burkholderia sp. PAMC 26561: AXG89_03645Help
Entry
AXG89_03645       CDS       T05481                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
bum  Burkholderia sp. PAMC 26561
Brite
KEGG Orthology (KO) [BR:bum00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AXG89_03645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AME23060
UniProt: A0A125SFT7
Position
1:complement(796844..797218)
Genome map
AA seq 124 aa AA seqDB search
MSQYEFSVAVQTQYLPEQSEPDAHQFAFAYTLTIRNTGQVAAQLISRHWIITDSDNVVQE
VKGLGVVGNQPLLPPGEKFEYTSWAVIATPVGTMRGSYFCVAEDGERFEAPIAEFALHMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtatgaattcagcgtagcggtccagacgcaataccttcctgaacaatcggaa
ccggatgctcaccagtttgcgttcgcatacacgctgaccattcggaataccggtcaggtc
gccgcgcaactgatctcgcggcactggatcatcacggatagcgacaacgtggtccaggaa
gtgaaagggcttggcgtggttggcaaccagcccttgttgccgccgggcgagaagttcgag
tacacgagttgggccgtgatcgcaacgccggtcggcaccatgcgcggatcgtatttctgt
gtggccgaagacggcgagcgtttcgaggcgcccattgccgagttcgcgctgcacatgccg
cgcacgcttcactga

DBGET integrated database retrieval system