KEGG   Burkholderia sp. PAMC 26561: AXG89_04330Help
Entry
AXG89_04330       CDS       T05481                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bum  Burkholderia sp. PAMC 26561
Pathway
bum03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bum00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AXG89_04330
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bum03011]
    AXG89_04330
Ribosome [BR:bum03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AXG89_04330
  Bacteria
    AXG89_04330
  Archaea
    AXG89_04330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AME23179
UniProt: A0A0X8L3E5
Position
1:complement(925809..926138)
Genome map
AA seq 109 aa AA seqDB search
MEVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAGIVKKVVLSAIANAEH
NEGADIDELKVTSIMVDKAASLKRFTARAKGRGNRIEKQSCHITVTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaaaagctattcatcgcggtgcccgcatctcggcgcagaaaacgcgtcttgtg
gctgaccagatccgtggtttgccggtcgacaaggcgctgaacgttctgacgttctcgccg
aagaaggcggcgggtattgtcaagaaggtcgtgttgtctgcgatcgcgaatgcggaacac
aacgaaggcgccgacatcgacgagctcaaggtaacgagcatcatggtcgacaaggccgct
tccctgaagcgttttaccgcgcgcgcaaaaggccgtggtaaccgcatcgagaagcaatcc
tgtcacatcactgtgacggtcgggaattaa

DBGET integrated database retrieval system