KEGG   Burkholderia sp. PAMC 26561: AXG89_06120Help
Entry
AXG89_06120       CDS       T05481                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bum  Burkholderia sp. PAMC 26561
Pathway
bum00970  Aminoacyl-tRNA biosynthesis
bum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bum00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AXG89_06120
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bum03029]
    AXG89_06120
Enzymes [BR:bum01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AXG89_06120
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AXG89_06120
Mitochondrial biogenesis [BR:bum03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AXG89_06120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AME23480
UniProt: A0A0X8L406
Position
1:1307247..1308740
Genome map
AA seq 497 aa AA seqDB search
MHQKSLTELRAALDAKTLSAVELAQVFLQRIGAAKDLNAFISVDHALTLEQAKAADALIA
QGKAGPLTGLPIAHKDVFVTRGWSSTAGSKMLENYKSPFDATVVDRLKNAGMVTLGKTNM
DEFAMGSSNENSYFGPVKNPWDLKAVPGGSSGGSAAAVAARLAPAATGTDTGGSIRQPAS
FTGVTGIKPTYGRVSRYGMIAFASSLDQGGPMARSAADCGVLLNAIASFDPRDSTSLERE
DEDYTRYIGQPWSGHDAARPLAGLRIGLPKEFFGEGLSAEVRRAVDAALKQYEALGATLV
EVSLPKTELSIPVYYIIAPAEASSNLSRFDGVRYGHRAAEYTDLLDMYKKSRAEGFGPEV
KRRILVGAYVLSHGYYDAYYVQAQKIRRIIAQDFQEAFNHCDVIMGPVAPSVAWNLGEKA
DDPVQMYLADIYTLSISLAGLPGMSVPCGFGAAGSAHATRPVGLQIIGNYFNEARLLQVA
DAFQRATDWHVQSPAGV
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgcatcagaaaagcttgaccgaactgcgcgcggcacttgacgcaaaaaccctttccgcc
gtcgaactcgcgcaggtgttcctgcagcgcatcggcgcagcgaaggatctcaacgccttt
atcagcgtcgatcacgcactcaccctcgagcaggcgaaagcagcggatgcgctcattgcc
caaggcaaagcgggtccgctgacgggtttgcccatcgcgcacaaggacgtgttcgtcacg
cgcggatggagctcgacggcgggctcgaagatgctcgagaactacaagagccccttcgat
gccaccgtcgtcgaccgcttgaagaacgcgggcatggtgacgctcggcaaaacgaatatg
gacgaatttgcgatgggttcgtcgaacgagaattcgtacttcggcccggtcaagaatccg
tgggacctgaaagcggttccgggcggatcgtcgggtggctcggctgcagcggtcgccgcg
cggctcgcgcccgccgctaccggcacggacacgggcggctcgattcgccagcctgcatcg
ttcacgggcgttacgggaatcaaacccacgtacgggcgcgtttcgcgttacggcatgatc
gcgttcgcttcgtcgctggatcagggcggccccatggctcgcagcgccgcggattgcggc
gtgttgctcaacgcgattgcatcgtttgatccacgcgattcgaccagcctcgagcgcgag
gacgaagactacacgcgttacatcggccagccctggtccggtcatgatgcggccaggccg
ctggcgggattgcgcatcggtttgccgaaggaattttttggcgaaggcttgagcgccgaa
gttcgccgcgcggtggacgcggcgttgaagcaatatgaagcgctcggcgcgacgctcgtc
gaggtatcgctgccgaagaccgagttgtcgattcccgtgtactacatcatcgcgccggcg
gaggcatcgtcgaatctgtcgcggttcgacggcgtgcgttacggccatcgcgcggccgaa
tacaccgatcttctcgatatgtacaagaagtcgcgcgccgagggtttcggaccggaagtg
aagcgccgaattctggtcggcgcgtacgtgttgtcgcacggctattacgacgcgtattac
gtccaggcgcaaaagatccgccgcatcatcgcgcaggatttccaggaagcattcaaccac
tgcgatgtgatcatgggaccggtcgcaccctccgttgcatggaatctcggcgagaaagcc
gatgatcccgtccagatgtatctcgccgatatctacacgttgtcgatcagtctcgccggc
ttgcctggcatgagcgtgccttgcggcttcggcgctgcgggcagtgcgcatgccacgcgg
ccggtcggcttgcagatcatcggcaactatttcaacgaagcccggttgctgcaggtcgcc
gacgcgtttcagcgcgcgaccgactggcatgtgcaatcacccgcaggagtctga

DBGET integrated database retrieval system