KEGG   Burkholderia sp. PAMC 26561: AXG89_07040Help
Entry
AXG89_07040       CDS       T05481                                 

Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
bum  Burkholderia sp. PAMC 26561
Pathway
bum00270  Cysteine and methionine metabolism
bum00480  Glutathione metabolism
bum01100  Metabolic pathways
Module
bum_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:bum00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AXG89_07040
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AXG89_07040
Enzymes [BR:bum01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     AXG89_07040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AME23633
UniProt: A0A125SGC7
Position
1:1504535..1505494
Genome map
AA seq 319 aa AA seqDB search
MDILFIADPLDHFKIYKDTTYAMMAEAARRGHALYACEPQHLAWVSGKVEGLVQRVSIVG
DVADSARSPWYSAATPELRDLKQFDAVLMRKDPPFDMEYVTTTWLLELAERTGARIFNKP
QAIRDHSEKLAIGEWPQFVVPTLVTRDADRLRAFHAEHGDVILKPLDGMGGMGVFRVKAD
GMNLGTIVEMLSDNGARSVMAQKFIPQITDGDKRILIIGGQPVPYSLARIPQGNEVRGNL
AAGGLGRAQPLTENDRKIAETLGQTLFNRGLLLVGLDAIGDYLTEVNVTSPTCFREIMDQ
TGFDVAGMFIDALERAVAI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggacatcctttttatcgccgatccgctcgatcatttcaagatctacaaagacacgacc
tacgcgatgatggccgaagccgcccgccgcgggcacgcgctctacgcgtgcgagccgcag
cacctggcctgggtgtcgggtaaggtcgaagggttggtgcaacgcgtgtccatagtcggc
gacgtggcggattccgcgcgttcgccgtggtattcggccgcaacgccggaactgcgcgat
ctgaagcagttcgatgccgttctgatgcgcaaagacccaccgttcgacatggaatacgtg
acgaccacctggctgctcgaattggccgagcgtaccggtgcacgcatcttcaacaagccg
caggcaatccgcgaccactccgaaaaactcgcaatcggcgaatggccgcaattcgtcgtg
ccgacgctggtcacccgtgacgccgaccggctgcgcgcgttccacgcagagcacggcgac
gtgatcctgaagccgctcgacggcatgggcggcatgggcgtgttccgcgtgaaagccgat
ggcatgaacctcggcacgatcgtggaaatgctgagcgacaacggcgcgcgcagcgtcatg
gcgcagaagttcatcccgcaaatcaccgatggcgacaaacgtattctgatcatcggcggg
cagccggtgccgtattcgcttgcgcggattccgcaaggcaacgaagtgcgcggcaatctg
gccgccggtggcttgggacgcgcgcaaccgctgaccgagaacgaccgcaagatcgctgaa
acgctggggcagacgctgttcaatcgcggcctgctgctggtcgggctcgacgccatcggc
gactatctcaccgaagtgaacgtcacgagcccgacgtgcttccgcgagatcatggatcag
accgggttcgatgtggcgggaatgtttatcgatgcactggagcgtgctgttgcaatttag

DBGET integrated database retrieval system