KEGG   Burkholderia sp. PAMC 26561: AXG89_13805Help
Entry
AXG89_13805       CDS       T05481                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
bum  Burkholderia sp. PAMC 26561
Pathway
bum00620  Pyruvate metabolism
bum00630  Glyoxylate and dicarboxylate metabolism
bum01100  Metabolic pathways
bum01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AXG89_13805
   00630 Glyoxylate and dicarboxylate metabolism
    AXG89_13805
Enzymes [BR:bum01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     AXG89_13805
    1.2.1.22  lactaldehyde dehydrogenase
     AXG89_13805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AME24770
UniProt: A0A120KXY4
Position
1:3025261..3026685
Genome map
AA seq 474 aa AA seqDB search
MRTYRNFIDGRLIDSSSDRFADVDNPATAEIIARVTLASRDDALAAVEAASRAQKTWRKL
SSIERGEHLRRFADAIVQRAPQIGAALALESGKSVADSENEARYAADITRYHAEWARRIE
GEVIPSDTLNENLVLHREPIGVVACLIPFNYPVYTLLRKVAPALITGNTVVVRPSNNTPM
SAFEIAEAARQAGLPAGIFNVLAMDHTTAATVCTHPAVGMITLTGSVNAGRIVLDYCKAN
IAKPSLELGGKAPAIIEPDADLEAAASAIVGSKTTHCGQLCTAMERVYVHASVHERFVEL
LRAKMSAVSFGDRSMDASKMGPLVSRSAQQDIHAMVQRAVAEGATVATGGTLPDTAGYFY
PPTLLLDCRHDMEIVREEIFGPVLPVISYGTLDEVLAMANDHQYGLSSVLYTENYRTAMR
VANEIEAGELYVNRTPADPYQGFHAGWKRSGLGGDDGKHGMLEFTQTRLVVMKY
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacctaccgtaatttcatcgacggccgcctgatcgactcatcgtccgatcggttt
gccgatgtcgacaaccccgccaccgctgagatcatcgcccgcgtcacgctcgcgtcccgg
gacgacgcgctcgccgccgtagaagccgcatcgcgggcgcagaaaacgtggcgcaagctg
agttccatcgagcgcggggagcatttgcgccgtttcgccgatgccatcgttcagcgcgcg
ccgcaaattggcgcggcgctcgcgctggaatcgggcaaaagtgtggcggattcggaaaac
gaagcccgctacgccgccgatatcacccgctatcacgccgaatgggcacgccggatcgaa
ggcgaagtcatccccagcgacacgctcaacgaaaacctcgtgctgcatcgcgagccgatt
ggtgtggtcgcctgcctgatcccgttcaactacccggtctacacgctcttgcgcaaggtc
gctccggcgttgatcacgggcaatacggtcgtggtacggccgagcaacaacacgcccatg
tccgctttcgaaatcgccgaagccgcgcgtcaggcgggactgccggccggcatcttcaac
gtgcttgcaatggaccacactacggcggccacggtctgcacgcatccggccgtcggcatg
atcacgctcaccggcagcgtgaacgccgggcgcatcgtgctggactactgcaaggcgaac
atcgcgaaaccttcgctggaactcggcgggaaggcgcccgcgatcatcgaaccggatgcc
gacctcgaagcggcagcgagcgcgatcgtcggatcgaagaccacgcattgcggccagttg
tgtaccgccatggaacgcgtgtatgtccacgcaagcgtgcacgagcgcttcgtcgaattg
ctgcgcgcgaagatgagcgccgtgagtttcggcgaccggtcgatggacgcatcgaagatg
ggaccgctggtgagccgctccgcccagcaagacattcacgcgatggtccagcgcgccgtg
gccgaaggcgctacggtcgcgaccggcggcacgctgcccgacaccgctggctatttctac
ccgcctacgctgctgctcgattgccgccacgacatggaaatcgtgcgcgaagaaatcttc
ggcccggtgctgccggtgatctcgtacggcacgctcgacgaagtcctcgcgatggcgaac
gaccatcagtacgggttgtcgtcggtgctttatacggagaactatcgcaccgccatgcgc
gtggccaatgagatcgaagccggcgagctgtacgtgaaccgcacgcccgccgatccgtat
caaggttttcacgctggctggaaacgctcgggactcggcggcgatgacggcaagcacggg
atgctcgaattcacgcagacccgcctcgtggtcatgaagtactga

DBGET integrated database retrieval system