KEGG   Burkholderia sp. PAMC 26561: AXG89_20450Help
Entry
AXG89_20450       CDS       T05481                                 

Definition
(GenBank) hypothetical protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bum  Burkholderia sp. PAMC 26561
Pathway
bum00970  Aminoacyl-tRNA biosynthesis
bum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bum00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AXG89_20450
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bum03029]
    AXG89_20450
Enzymes [BR:bum01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AXG89_20450
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AXG89_20450
Mitochondrial biogenesis [BR:bum03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AXG89_20450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AME26266
UniProt: A0A0X8L9A5
Position
2:complement(1112278..1112913)
Genome map
AA seq 211 aa AA seqDB search
MPERRYPTMDDLKIAEPGILERFRTTIADLEAMGAVLEQKPLPRSLETYASLGANITTVE
AWDRYGPLVDMENSLVNAEIAKRMSRGKTMNIKDYLSYDAQRRLLQTEIYHYFAGADAIL
LPSSPITAKPIEGAHDAAAPFGLFTRLVNLMDLASLSIPMGDVEGLPTAVQIVVRRYADP
LAFQIGRALEVQRGGLFAPASGYGLLDGPAA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagcggcgctatccgaccatggatgacctcaaaatcgcagaacccgggatccta
gagcgattcaggacgacgatcgctgatctcgaagcgatgggcgcggtcctcgagcagaag
ccactacctcgctcgctcgaaacatatgcgagcctcggtgccaacatcacgaccgtggag
gcttgggaccgttacggccctcttgtcgatatggagaacagtctcgtcaacgcggaaatt
gcgaagcggatgtcgcgcggcaaaacgatgaacatcaaggactacctcagctacgacgcg
cagcggcggctgttgcaaacggagatctatcactacttcgcaggtgcggatgccatactg
cttccctcctcgccgattacggcaaagcccatagaaggagcgcacgacgcagccgcgccg
tttggtctttttacccgtctcgttaatctgatggacctcgcttccctgagcatacctatg
ggagatgtcgagggcctccccaccgctgttcagattgttgttcgtcgctacgccgacccc
ctggcttttcaaatcggacgcgcgctcgaagtccagcgcggtggattgtttgcgcctgct
tccggctacggcctcctggatggcccggcagcatag

DBGET integrated database retrieval system