KEGG   Burkholderia insecticola: BRPE64_ACDS09600Help
Entry
BRPE64_ACDS09600  CDS       T02684                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
buo  Burkholderia insecticola
Pathway
buo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:buo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BRPE64_ACDS09600 (recD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:buo03400]
    BRPE64_ACDS09600 (recD)
Enzymes [BR:buo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BRPE64_ACDS09600 (recD)
DNA repair and recombination proteins [BR:buo03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BRPE64_ACDS09600 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 AAA_11 Helicase_RecD Viral_helicase1 SH3_13 UvrD-helicase DUF2075 AAA_25 PhoH PriC AAA_22 Bcl-2 T2SSE AAA AAA_lid_4 Flavi_DEAD UvrD_C MukB CbiA
Motif
Other DBs
NCBI-ProteinID: BAN22714
UniProt: R4WG71
Position
1:1020007..1022082
Genome map
AA seq 691 aa AA seqDB search
MSTLGIIEGARPVPAPADESAALADGFARRIGDLARRIGADERAVLWAERAAGAMSRATV
QGHVCLSLAALARRHDERFDEARSALLASGVACSVRDNRRADAADLLPLVIDEDGRLYLA
RYFDYERRLAQALVERSRDAQVQTQTQTVQQDIARQAERIARYFGTDASGDIDWQRVAAL
VALAGKLTIVSGGPGTGKTTTVVGVLACLLDADPALRIALAAPTGKAAQRMQEALIERAD
KLPPELAERLPRTSFTLQRLLGVQADGRFRHHRDNPLPYDVIVVDEASMIDVALAAHLLE
AIAPASRLVMLGDKDQLSAVEAGAVFAELSATPSFSRAGVARIASALALDPKRLEAALPH
AEAPKRAAPAVSVTSTKPAAPRDPQLELFAPEPADDAQGYDELFDTLPEDWQGGAAATTE
QPALTDCVVWLQKNYRFGLESDIGRLSIAIRNGDDRAALDALDSSGERAATLFDDGDAAL
AERTLARLARGFAPYAEALAAALDGVPSDHARLFDALNHFRVLCATRRGPRGVDDVNARI
AAKVREQAGIALALGAQWFAGRPVIVTRNDYALGLFNGDIGIALPGADGLLRVAFRMADG
ALRYVSPAALPPHDTAFALTVHKSQGSEFEHAALVLPGVFGRVLSRELIYTAITRAKRRV
EVIGSAAIFAQAVREPTRRDSGLAARMRRLT
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgctcggcatcatcgaaggcgcgcggcccgtgcccgcgcccgccgacgaaagc
gcggcgctcgcggacggcttcgcgcggcgcatcggcgatttggcacggcgcatcggcgcg
gacgagcgcgcggtcttgtgggccgaacgcgcggccggcgcgatgagccgcgcgaccgtg
caaggccacgtgtgcctgtcgctggccgcgctcgcgcggcgtcacgacgaacgcttcgac
gaagcacgcagcgcgctgctcgcgagcggcgttgcgtgcagcgtgcgcgacaatcggcgc
gcggatgccgccgatctgctgccgctcgtcatcgacgaagacgggcggctctatctcgcg
cgctatttcgactacgagcggcggctcgcgcaggcgctcgtggaacgttcgcgagatgcg
caagtgcagacccagacccagaccgtacagcaagacatcgcgcggcaggccgaacgcatc
gcgcgctatttcgggacggacgcaagcggcgacatcgactggcaacgcgtcgcggcgctc
gtggcgctggcgggcaagctgacgatcgtgagcggcggtccgggcaccggcaagacgacc
accgtcgtcggcgtgctcgcgtgtctgctcgacgccgatccggccttgcgcatcgcgctc
gccgcgccgaccggcaaggccgcgcaacgcatgcaggaagcgctgatcgagcgcgcggac
aagctgccgccggaactggccgagcgtctgccgcgcacgtcgttcacgttgcagcgcctg
ctgggcgtgcaggcggacggccgcttccggcatcatcgcgacaatcctttgccttatgac
gtgatcgtcgtcgacgaagcctcgatgatcgacgttgcgctcgcggcgcatttgctcgaa
gccatcgcgccggcgagccggctcgtcatgctgggcgacaaggatcaactgtcggccgtg
gaggcgggtgcggtgttcgccgaactgagcgcgacgccttcgttcagtcgcgcgggcgtc
gcgcgaatcgcctcggcgctcgcactcgatccgaagcggctcgaagcggcgctgccgcac
gccgaagcgcccaagcgcgccgcacccgctgtgtccgttacgtccaccaaacctgccgca
ccgcgcgatccgcaactcgaactgttcgcgcccgaacccgccgacgatgcgcaaggctac
gacgaactcttcgacacactcccggaagactggcagggtggtgccgctgccacaaccgaa
cagccggcgctcaccgattgcgtcgtctggttgcagaagaactaccgtttcgggctcgaa
tcggacatcgggcgtttgtcgatcgccatccgcaacggcgacgaccgcgccgcgctcgac
gccctcgacagctccggcgagcgtgcggccaccctgttcgacgacggcgacgccgcgctt
gccgagcgcacgctcgcacgcctcgcgcgaggcttcgcgccgtatgccgaagcgcttgcc
gccgcgctcgacggcgtgccgtccgatcacgcccggctcttcgacgcgctcaaccacttc
cgcgtcctgtgcgcgacgcgccgcggaccgcgcggcgtggacgatgtgaacgcgcgcatc
gccgcgaaagtgcgcgagcaggcgggcatcgcgctggcgctgggggcgcaatggttcgcc
gggcggccggtgatcgtcacgcgcaacgactacgcgctcgggcttttcaacggcgatatc
ggcattgcgctgccgggcgccgacggtcttctgcgcgtcgccttccgcatggcggacgga
gcgttgcgctacgtatcgcccgccgcgctgccgccgcacgacaccgcgttcgcgctcacc
gtgcacaaatcgcaaggctccgagttcgagcacgcggcgctcgtgctgcccggcgtgttc
gggcgcgtgttgtcgcgcgagctgatctatacggcgatcacgcgggcgaagcggcgcgtc
gaagtgattggctcggcggcgatcttcgcgcaggcggtcagggagccgacgcggcgcgat
tccgggctggctgcgagaatgcgccgtctcacatga

DBGET integrated database retrieval system