KEGG   Burkholderia sp. RPE64: BRPE64_ACDS13270Help
Entry
BRPE64_ACDS13270  CDS       T02684                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
buo  Burkholderia sp. RPE64
Pathway
buo00220  Arginine biosynthesis
buo00250  Alanine, aspartate and glutamate metabolism
buo00290  Valine, leucine and isoleucine biosynthesis
buo01100  Metabolic pathways
buo01110  Biosynthesis of secondary metabolites
buo01130  Biosynthesis of antibiotics
buo01210  2-Oxocarboxylic acid metabolism
buo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:buo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BRPE64_ACDS13270
   00290 Valine, leucine and isoleucine biosynthesis
    BRPE64_ACDS13270
   00220 Arginine biosynthesis
    BRPE64_ACDS13270
Enzymes [BR:buo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     BRPE64_ACDS13270
    2.6.1.66  valine---pyruvate transaminase
     BRPE64_ACDS13270
Amino acid related enzymes [BR:buo01007]
 Aminotransferase (transaminase)
  Class I
   BRPE64_ACDS13270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: BAN23081
UniProt: R4WVV5
Position
1:1368315..1369553
Genome map
AA seq 412 aa AA seqDB search
MKPILKSNKLQNVCYDIRGPVLEHAKRLEEEGHRIIKLNIGNLAPFGFEAPDEIIQDMIR
NLPGSSGYSDSKGVFAARKAIMHYTQQKGVTGVELDDIYIGNGASELIVMAMQALLNDGD
EVLLPAPDYPLWTAAVSLSSGTPRHYMCDESNGWMPDLDDIRAKITPNTKALVVINPNNP
TGALYSDELLLDLISIAREHGLIIFADEVYDKIIYDGMTHTSMAALSEDVITVTFNSLSK
SYRSCGYRAGWMAISGLIEENRRRAKDYLEGLGILASMRLCPNVPGQYAIQTALGGYQSI
NDLILPGGRLFKQRELAYDMLTAIPGVSCVKPQAALYMFPKLDPKMYPIQDDQQFITDLL
LEERVLLVQGTGFNWPTPDHFRVVFLPNVDDLADSINRIARFLDGYRKRHFA
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccgattctcaaatccaacaagctgcaaaacgtctgctacgacattcgcgggccc
gtgctcgaacacgcgaagcgcctcgaagaggaaggccatcgcatcatcaagctcaatatc
ggcaatttggcgccgttcggcttcgaggcgccggacgagatcattcaggacatgatccgc
aatctgccgggcagttcgggctattcggattcgaagggcgtgttcgccgcgcgcaaggcg
atcatgcattacacgcagcaaaagggcgtgacgggcgtcgaactggacgacatctacatc
ggcaacggcgcgtcggaactcatcgtcatggcgatgcaggccttgctcaacgacggcgac
gaagtgctcctgcccgcgcccgactatccgctctggacggctgcggtgagcctgtcgtcc
ggcacgccgcgccattacatgtgcgacgagagcaacggctggatgcccgatctcgacgac
atccgcgcgaagatcacgcccaacacgaaggcgctcgtcgtcatcaacccgaacaatccg
accggcgcgctgtattcggacgaattgctgctcgatctgatttcgatcgcgcgcgagcac
ggcttgatcattttcgcggacgaggtctacgacaagatcatctacgacggcatgacgcat
acgtcgatggccgcgctctccgaagacgtgatcaccgtcacgttcaacagtttgtcgaag
agctatcgttcgtgcggttatcgggcgggctggatggccatttccggtctgatcgaagag
aatcgccggcgcgcgaaggattatctcgaaggcctcggcattctggcctcgatgcgcctg
tgcccgaacgtgcccggccagtacgcgatccagacggcgctgggcggctatcagagcatc
aatgacctgatcttgccgggcggacggctcttcaagcagcgcgaactcgcctacgacatg
ctcacggccattccgggcgtgagctgcgtgaagccgcaagccgcgctgtacatgttcccg
aagctcgatccgaagatgtacccgatccaggacgaccagcagttcatcaccgacctgctg
ctcgaggagcgcgtgctgctcgtgcagggtacgggcttcaactggccgacgccggatcac
ttccgcgtggtcttcctgccgaacgtcgacgatctcgcggattcgatcaaccgcatcgcg
cgcttcctcgacggctatcgcaaacggcatttcgcttaa

DBGET integrated database retrieval system