KEGG   Burkholderia insecticola: BRPE64_ACDS15610Help
Entry
BRPE64_ACDS15610  CDS       T02684                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
buo  Burkholderia insecticola
Pathway
buo00071  Fatty acid degradation
buo00072  Synthesis and degradation of ketone bodies
buo00280  Valine, leucine and isoleucine degradation
buo00310  Lysine degradation
buo00362  Benzoate degradation
buo00380  Tryptophan metabolism
buo00620  Pyruvate metabolism
buo00630  Glyoxylate and dicarboxylate metabolism
buo00640  Propanoate metabolism
buo00650  Butanoate metabolism
buo00900  Terpenoid backbone biosynthesis
buo01100  Metabolic pathways
buo01110  Biosynthesis of secondary metabolites
buo01120  Microbial metabolism in diverse environments
buo01130  Biosynthesis of antibiotics
buo01200  Carbon metabolism
buo01212  Fatty acid metabolism
buo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:buo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BRPE64_ACDS15610
   00630 Glyoxylate and dicarboxylate metabolism
    BRPE64_ACDS15610
   00640 Propanoate metabolism
    BRPE64_ACDS15610
   00650 Butanoate metabolism
    BRPE64_ACDS15610
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BRPE64_ACDS15610
   00072 Synthesis and degradation of ketone bodies
    BRPE64_ACDS15610
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BRPE64_ACDS15610
   00310 Lysine degradation
    BRPE64_ACDS15610
   00380 Tryptophan metabolism
    BRPE64_ACDS15610
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BRPE64_ACDS15610
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BRPE64_ACDS15610
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BRPE64_ACDS15610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:buo04147]
    BRPE64_ACDS15610
Enzymes [BR:buo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BRPE64_ACDS15610
Exosome [BR:buo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRPE64_ACDS15610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAN23315
UniProt: R4WQX2
Position
1:complement(1615330..1616514)
Genome map
AA seq 394 aa AA seqDB search
MEREVVVVSGVRTAIGDFGGALKDFTPSDLGARVVREALARANVAGDEVGHVVFGNVIQT
EPRDMYLARVAALDGGVTQHAPALTVNRLCGSGLQAIVSASQSILLGDADIAIGGGAENM
SRAPYIMPAARFGQRMGDARIVDMMVGALNDPFDKIHMGVTAENVAQKYGITREMQDALA
LESHRRAAKAIEAGYFKEQILPITLASKKGDTLFERDEHVRMNATAEDFAKLKPVFAKEN
GSVTAGNASGINDAAAAVVLMERSVAEKRGAKPLARLVAYAHAGVDPKIMGIGPVPATQK
VLERAGLSVADLDVIEANEAFAAQACAVSQELKFDPAKVNPNGSGISLGHPIGATGALIT
VKALYELQRIGGRYALVTMCIGGGQGIAAIFERI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtgaagtggtagtggtgagcggcgtgcgcacggccatcggcgatttcggcggc
gcactgaaggacttcacgccgagcgatctcggcgcgcgcgtcgtgcgcgaggcgcttgcg
cgtgcaaacgtcgcgggcgacgaagtgggtcacgtggtgttcggcaacgtgatccagacc
gaaccgcgcgacatgtacctggcgcgcgtcgccgcgcttgacggcggcgtcacgcaacac
gcgcccgcgctcacggtgaaccggctgtgcggctcgggcctgcaggcgatcgtgtcggcg
tcgcaatccatcttgctgggcgacgccgatatcgccatcggcggcggcgcggaaaacatg
agccgcgcgccgtacatcatgcccgccgcgcgcttcgggcagcgcatgggcgacgcgcgt
atcgtcgacatgatggtcggcgcgctgaacgatccgttcgacaagattcatatgggcgta
accgccgaaaacgtcgcgcagaagtacggcatcacgcgcgagatgcaggacgcgctcgcg
ctcgaatcgcatcggcgcgcggcgaaagcgatcgaagccggctacttcaaggaacagatc
ctgccgatcacgcttgcctcgaagaagggcgacaccttgttcgagcgcgacgagcacgtg
cgcatgaacgcaaccgccgaagacttcgcgaagctcaaacccgtgttcgcgaaggaaaac
ggctcggtgacggccggcaacgcgtccggcatcaacgacgcggcggcggccgtcgtgctg
atggagcgcagcgtcgcggaaaagcgcggcgcgaaaccgctcgcgcggctggtggcgtac
gcgcacgcgggcgtcgatccgaagatcatgggcatcggcccggtgcccgccacacagaag
gtgctggaacgcgcgggcctgagcgtggccgatctcgacgtcatcgaggccaacgaggcg
ttcgccgcgcaagcctgcgccgtctcgcaggaactgaagttcgatccggcgaaggtcaac
ccgaacggctcgggcatttcgctcggccatccgatcggcgcgacgggcgcgctcatcaca
gtgaaggcgctgtacgaactgcagcgcatcggcggacgctacgcgctcgtgacgatgtgc
atcggcggcgggcagggcatcgcggcgattttcgagcgcatttga

DBGET integrated database retrieval system