KEGG   Burkholderia insecticola: BRPE64_ACDS22780Help
Entry
BRPE64_ACDS22780  CDS       T02684                                 

Definition
(GenBank) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
buo  Burkholderia insecticola
Pathway
buo00380  Tryptophan metabolism
buo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    BRPE64_ACDS22780
Enzymes [BR:buo01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     BRPE64_ACDS22780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase Sec7_N
Motif
Other DBs
NCBI-ProteinID: BAN24032
UniProt: R4WZS9
Position
1:2377559..2378434
Genome map
AA seq 291 aa AA seqDB search
MDETKGCPFGHGAAQTGQETGWHDAKLDFADSMSYGDYLGLDSILTAQHPLSPDHNEMLF
IVQHQTSELWMKLALYELRAALAAVHRDALPPAFKMLARVSRIFEQLVQAWNVLATMTPS
EYTAMRPYLGQSSGFQSHQYRQIEFMLGNKNPQMLQPHAHRPDILAQVRETLEAPSFYDE
VIRLLARRGFEIDPARLNRDWTQPTTADPTVEAAWLAVYRDPSHHWDLYEMAEELVDLED
AFRQWRFRHVTTVERIIGFKGGTGGTAGASYLRKMLDVVLFPELWHVRTVL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggacgaaaccaaaggctgcccgttcggccacggcgccgcacaaaccggccaggaaaca
ggttggcacgacgccaagctcgattttgcagactcgatgagctacggcgattatctcggc
ctcgattcgatcctgaccgcgcagcatccgctgtcgccggatcacaacgagatgctgttc
atcgtgcagcatcagacgagcgagctatggatgaagctcgcgctctacgaactgcgcgcg
gcgctcgcggcggtgcatcgcgacgcattgccgcccgcgttcaagatgctcgcgagggtg
tcgcgcattttcgagcaactggtgcaggcgtggaacgtcctcgcgacgatgacgccctcc
gaatacacggcgatgcgtccgtatctcggccagtcgtcgggttttcagtcgcatcagtat
cggcagatcgagttcatgctcggcaacaagaatccgcagatgctccagccgcatgcgcat
cggccggatattctcgcgcaggtgcgcgagacgctggaggcgccctccttctacgacgaa
gtgatccgcctgctcgcgcggcgcggcttcgagatcgacccggcgcgcctgaaccgcgac
tggacgcagccgaccacggcggatcccaccgtcgaggcggcgtggctcgcggtgtatcgc
gatccgtcgcatcactgggatctttacgagatggcggaggaactcgtcgatctcgaagac
gcgttccggcaatggcgcttccgccacgtgacgacggtcgagcgcatcatcggcttcaag
ggcggtacgggcggcacggcgggcgcgtcgtatctgcgcaagatgctcgatgtcgtgctg
tttccggaactctggcatgtgcggacggtgctctga

DBGET integrated database retrieval system