KEGG   Burkholderia insecticola: BRPE64_DCDS00780Help
Entry
BRPE64_DCDS00780  CDS       T02684                                 

Gene name
aldA
Definition
(GenBank) aldehyde Dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
buo  Burkholderia insecticola
Pathway
buo00620  Pyruvate metabolism
buo00630  Glyoxylate and dicarboxylate metabolism
buo01100  Metabolic pathways
buo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:buo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BRPE64_DCDS00780 (aldA)
   00630 Glyoxylate and dicarboxylate metabolism
    BRPE64_DCDS00780 (aldA)
Enzymes [BR:buo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     BRPE64_DCDS00780 (aldA)
    1.2.1.22  lactaldehyde dehydrogenase
     BRPE64_DCDS00780 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: BAN27014
UniProt: R4WQY9
Position
p1:72568..73971
Genome map
AA seq 467 aa AA seqDB search
MNGRFIEPAGDNVTVILNPATEEVAGHVHNASREQALLAVEQAAGAQRQWRLMPAAERGA
LMQRLADAIVEASAEIGAALAKESGKSLVDATNEAVYAAQITRYHAEWARRIEGEVIPSD
TPDENLVLHREPIGVVACLIPFNFPIYTLMRKVAPALIAGNTVVVRPSNNTPLSAFELAR
AVERAALPAGVINILAMEHATAEVVCTHPKVGMITLTGSVNAGRKVLEYCKANIAKPSLE
LGGKTPAIVEPDADLQKAARELVASKLTHSGQLCTAIERVYVHESIHDEFVGMLRAQMQA
KQIGDRYEDASRMGPLVNKASRDGIHAMVRRAVEAGAKLETGGEVPDRKGFFYPPTLLSN
CRQDMEIVQEETFGPVLAVLKYSTIDEAIALANDHQFGLSSVLYTENYRTAMKVANSIEA
GELYINRTPADPYQGFHAGWKRSGIGGDDGKHGMLEFTQTRLVVMKY
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgggcgtttcatcgagcccgcaggcgacaacgtcactgtcatcctcaatcccgcc
accgaagaagtcgcgggccacgtgcataacgcgtcgcgcgagcaggcgctgcttgcggtc
gagcaagccgccggcgcgcaacgtcaatggcgcctgatgcccgccgccgagcgcggcgca
ctgatgcagcgtctcgcggatgccatcgtcgaggcgtcggcggagattggcgccgcgctc
gcgaaagagtccggcaagagtctggtcgatgccaccaacgaagccgtgtacgccgcgcag
atcacgcgctatcacgcggaatgggcgcgccgtatcgaaggcgaagtcattccgagcgat
acgcccgatgaaaacctcgtgctgcatcgcgagccgattggcgtcgtcgcgtgcctgatt
ccgttcaatttccccatctacacgctgatgcgcaaggtcgcgcccgcgctgatcgcgggt
aacacggtcgtcgtgcgtccgagcaacaacacgccgctgtcggcgttcgaactcgcgcgc
gccgtcgaacgtgcggcgctgccggcgggcgtcatcaacattctggcgatggaacacgcc
acggccgaagtcgtgtgcacgcatccgaaggtcggcatgatcacgctgacgggtagcgtc
aacgcgggtcgcaaggtgctggagtattgcaaggcgaacatcgcgaagccgtcgctggaa
ctcggcggcaagacgcccgcgattgtcgagccggatgcggacttgcagaaggccgcgcgt
gaactcgtcgcatcgaagcttacgcacagcggccagctctgcacggcaatcgagcgcgtg
tatgtgcacgaaagcattcacgatgaattcgtcggcatgctgcgcgcgcagatgcaggcg
aagcagatcggcgaccgctacgaggacgcgagccgcatgggtccgctcgtgaacaaggct
tcgcgcgacggcattcacgcgatggtccgccgcgcagtcgaagcgggcgcgaagctcgaa
accggcggcgaagtgccggatcgcaagggctttttctatccgccgacgctgctctcgaat
tgccgtcaggacatggagatcgtgcaggaagagaccttcgggccggtgctcgcggtgctc
aagtacagcacgatcgacgaagcgatcgccctggcgaacgatcatcagttcgggctttcg
tcggtgctgtacaccgagaactatcgtacggcgatgaaggtcgccaattcgatcgaagcg
ggcgagctgtatatcaaccgcacgccggccgatccgtatcaaggattccacgcgggctgg
aaacgctcgggcatcggcggcgacgacggcaagcacggcatgctcgaattcacgcagacg
cgtctcgtcgtcatgaagtactga

DBGET integrated database retrieval system