KEGG   Burkholderia sp. RPE64: BRPE64_DCDS12180Help
Entry
BRPE64_DCDS12180  CDS       T02684                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
buo  Burkholderia sp. RPE64
Pathway
buo00071  Fatty acid degradation
buo00072  Synthesis and degradation of ketone bodies
buo00280  Valine, leucine and isoleucine degradation
buo00310  Lysine degradation
buo00362  Benzoate degradation
buo00380  Tryptophan metabolism
buo00620  Pyruvate metabolism
buo00630  Glyoxylate and dicarboxylate metabolism
buo00640  Propanoate metabolism
buo00650  Butanoate metabolism
buo00900  Terpenoid backbone biosynthesis
buo01100  Metabolic pathways
buo01110  Biosynthesis of secondary metabolites
buo01120  Microbial metabolism in diverse environments
buo01130  Biosynthesis of antibiotics
buo01200  Carbon metabolism
buo01212  Fatty acid metabolism
buo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:buo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BRPE64_DCDS12180
   00630 Glyoxylate and dicarboxylate metabolism
    BRPE64_DCDS12180
   00640 Propanoate metabolism
    BRPE64_DCDS12180
   00650 Butanoate metabolism
    BRPE64_DCDS12180
  Lipid metabolism
   00071 Fatty acid degradation
    BRPE64_DCDS12180
   00072 Synthesis and degradation of ketone bodies
    BRPE64_DCDS12180
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BRPE64_DCDS12180
   00310 Lysine degradation
    BRPE64_DCDS12180
   00380 Tryptophan metabolism
    BRPE64_DCDS12180
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BRPE64_DCDS12180
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BRPE64_DCDS12180
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BRPE64_DCDS12180
Enzymes [BR:buo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BRPE64_DCDS12180
Exosome [BR:buo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRPE64_DCDS12180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: BAN28154
UniProt: R4WUB9
Position
p1:complement(1265934..1267103)
Genome map
AA seq 389 aa AA seqDB search
MIVSAARTAVGKFGGSLAKIAAPELGATVIRAVLERAGVKPDQVSEVILGQVLAAGSGQN
PARQSLIKAGLPDMVPGMTINKVCGSGLKAVMLAANAIIAGDAEIVIAGGQENMSAAPHV
LPGSRDGFRMGDAKLIDSMIVDGLWDVYNNYHMGTTAENVAREFGITREQQDAFAALSQN
KAERAQKEGRFNDEIVPVSIPQRKGEPLQFATDEFVRHGVTAEALSSLKPAFSKEGTVTA
ANASGINDGAAAVVVMSAKKAEALGLTPLARIKAYANAGVDPKIMGMGPVPASKRCLERA
GWSVNDLDLMEINEAFAAQALAVHKQMGWDQSKINVNGGAIAIGHPIGASGCRILVTLLH
EMQKRDAKKGLASLCIGGGMGVALALERP
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtatcggccgcgcgcacggcggtaggcaaattcggcggctcgctcgcgaaaatc
gcggcgccggaactgggcgcgacggtgatccgcgccgtgctggagcgcgcaggcgtaaag
ccggatcaggtgagcgaagtgatcctgggccaggtgctcgcggcaggttcgggccagaac
ccggcgcgccagtcgctgatcaaggcagggctgcccgacatggtgcccggcatgacgatc
aacaaggtctgcggctcgggcctgaaggcggtgatgctggcggccaacgcgatcatcgcg
ggcgatgcggagatcgtgatcgcaggcggtcaggaaaacatgagcgcggcgccgcacgta
ctgccgggttcgcgcgacggctttcgcatgggcgacgccaagctgatcgactcgatgatc
gtcgacggtctgtgggacgtctataacaactaccacatgggcacgacggcggaaaacgtc
gcgagggaattcggcatcacgcgcgagcagcaggacgcgttcgcggcgctgtcgcagaac
aaggccgagcgcgcgcaaaaagaaggccgcttcaacgacgaaatcgtgccggtctcgatc
ccgcaacgcaaaggcgagccgctgcaattcgccaccgatgaattcgtgcgccacggcgta
acggccgaagcgctttcatcgttgaaaccggcgttctcgaaggaaggcacggtgacggcg
gcgaacgcttcgggcatcaacgatggcgcagccgccgtggtcgtcatgtcggcgaagaag
gccgaggcgctgggtctcacgccgctcgcgcgcatcaaggcgtacgcgaacgcaggcgtc
gatccgaagatcatgggcatgggtccggtgccggcatcgaagcgctgtctggagcgcgcg
ggctggagcgtgaacgatctcgatctgatggagatcaacgaggcattcgccgcgcaggcg
ctggcggtgcacaagcaaatgggctgggatcagtcgaagatcaacgtgaacggcggggcg
attgcgatcggtcatccgatcggcgcatcgggctgccggattctcgtcacgctgctgcac
gaaatgcagaagcgcgatgcgaaaaagggtctggcgtcgctgtgtatcggcggcggcatg
ggcgtggcgctggcgctggagcgcccgtaa

DBGET integrated database retrieval system