KEGG   Buchnera aphidicola TLW03 (Acyrthosiphon pisum): CWQ_00520Help
Entry
CWQ_00520         CDS       T01829                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
bup  Buchnera aphidicola TLW03 (Acyrthosiphon pisum)
Pathway
bup00340  Histidine metabolism
bup01100  Metabolic pathways
bup01110  Biosynthesis of secondary metabolites
bup01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bup00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    CWQ_00520 (hisD)
Enzymes [BR:bup01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     CWQ_00520 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ADP66496
Position
105091..106398
Genome map
AA seq 435 aa AA seqDB search
MKYFKNIIFWNKLHLDEQKKILSRPILKENNFIKKTVKEIIENVRLFGNSALKKYTFLFD
KQDINTFQVSKEKISSSSFYLSKVLKDSISVAQKNITCFHKAQIPSKIDVETEVGVRCEQ
IYLPLNSIGIYIPGGTAPLFSTVLMLAIPAKISGCKKIILCSPPPISNEVLYAAHICGIH
DIYQVGGAQAIAALALGTETVPKVDKIFGPGNAYVTEAKLQVSSIFNGTEIDMLAGPSEL
LIIADNTANPDFIAADLLSQAEHGVSSQVILLTPCFELAEKVVLSINKQLNNLSRLSEIL
KTLKNSSVIIVKNLSECIEISNMYAPEHLIIQTQSPREVLNYISNASSIFLGLWSPESAG
DYASGTNHVLPTYGKSITNSSLGLCDFQKRVLVQELTAKGLMKLSNTIEILSSAEKLQAH
KNAVKIRVDFLKGKI
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattttaaaaatataattttttggaacaaactacatcttgatgaacaaaaaaaa
atattatcaagacctattttaaaagaaaataacttcattaaaaagactgtaaaagaaatt
atagaaaatgttagattatttggaaattcagcattaaaaaaatatacttttttatttgat
aaacaagatataaatacatttcaagtttcaaaagaaaaaatctcttcatcttcgttttat
ttaagtaaggttctaaaagattccatttctgtcgcgcaaaaaaatattacatgttttcat
aaagctcaaattccatctaaaatagatgttgaaacagaagttggagtccgttgtgagcaa
atctatttacctctaaattctataggaatttatattcctggcggaacagctcctttattt
tcgactgtattaatgttagcgatacctgctaaaatttctggttgtaaaaaaattattctt
tgctctcctcctccgattagtaacgaggttctttatgctgctcatatttgtggaattcat
gatatttatcaagttgggggagctcaggctatagctgcactcgctttaggtactgaaacg
gtccctaaagtagataagatttttggaccaggcaatgcgtatgttacagaagcaaaatta
caagttagttcaatctttaatggaacagaaatagacatgttagcaggaccttcagaatta
ttaatcattgctgacaacactgctaatccagattttattgccgctgatttattatcacaa
gctgaacatggtgtttcttctcaagtaattttgcttacaccatgttttgaattagcagaa
aaggtagtgctttccattaataaacaactgaataatttatctagattatcagaaattttg
aaaacattaaaaaacagtagtgtcataattgtcaaaaatttatcagaatgtattgaaatc
tctaatatgtatgcacctgaacatctaattattcaaacacaatcacctagagaagtactt
aactacatctctaatgctagttctatttttcttggtttatggtctcctgaatctgccgga
gattatgcgtctgggacaaatcatgttttaccaacatatggaaaatctattacaaattcg
tctttaggattgtgtgattttcaaaaacgtgtattagttcaagaattaacagctaaagga
ctaatgaaattatctaatactattgaaattttatcttccgcagaaaaacttcaagcacat
aaaaatgctgtaaaaattcgcgtagattttttaaagggaaaaatatga

DBGET integrated database retrieval system