KEGG   Buchnera aphidicola TLW03 (Acyrthosiphon pisum): CWQ_01270Help
Entry
CWQ_01270         CDS       T01829                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bup  Buchnera aphidicola TLW03 (Acyrthosiphon pisum)
Pathway
bup00900  Terpenoid backbone biosynthesis
bup01100  Metabolic pathways
bup01110  Biosynthesis of secondary metabolites
bup01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bup00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CWQ_01270
Enzymes [BR:bup01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CWQ_01270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ADP66631
Position
258689..259885
Genome map
AA seq 398 aa AA seqDB search
MKKITILGSTGSIGINALSIIQKNPDLFKVIALVANKNFSIMLRQCELFSPDWVAMRDEK
SAHILRKKLKHSKINTQVLTGEKDICALAALEETDHVISAIVGMAGLLPTLSAIHAGKTI
LLANKESLITSGYFFMKALSSSGAKIIPIDSEHNAIFQVLPLEIQKNLGKTTLEKNSIKH
LVLTGSGGPFYKFSSSDLSNVTPDQACSHPNWLMGKKISVDSATMMNKGLEYAEARWLFN
ALESEIKILIHPESIIHSMVQYYDGSLLAQLSAPDIRTSISYAMSWPDRICTEVDYLNFY
KINNLTFFEPDFTQFPCLKLAIDAFSQGQASMTVLNAANEIAVSSFLDSKISFTKIYEIN
MEILMSSCFSEPKCIQDILEIDRKVRILAKNKVSSLIF
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatcactattttaggatctactggttccattggtattaacgcgctatctatt
attcaaaaaaatccagatttatttaaggtaattgctttagtagctaataaaaatttttct
attatgttacgtcaatgtgagttattttctcctgattgggtggctatgagagacgagaaa
tctgctcatatattaagaaaaaaattaaaacatagtaaaatcaatactcaagttcttact
ggagaaaaagatatttgtgcgttagctgcattagaagaaacagatcacgttatatctgca
attgttggaatggctggtttgttaccgacgttatctgcaatacatgctggcaaaacaata
ttattagctaataaagaatctttaattacaagtggttatttttttatgaaagcactttct
tcaagtggcgcgaaaattattcctattgatagcgaacataatgctatttttcaagtgtta
cctttagaaattcaaaaaaacttaggtaaaactactctagagaaaaatagtatcaagcat
cttgttttaactggttctggaggtccgttttataaattttcttcatctgatttatctaat
gtgactccagatcaagcttgttctcatcccaattggttgatgggaaaaaaaatttctgta
gattcagctactatgatgaataaaggtttagaatatgctgaagcaagatggttatttaat
gctttggaatcagaaattaaaattttaattcatcctgaatcaattattcattctatggtg
cagtattatgatggttctttattagcacaattatcagcacctgatataagaacatctatt
tcatatgcaatgtcttggcctgaccgtatttgcacagaagttgattatttaaatttttat
aaaataaataatctaacttttttcgaacctgattttactcagtttccatgtctaaagtta
gctattgatgctttttctcaagggcaggcttctatgacggttttaaatgccgctaatgaa
attgccgtgtcatcttttctcgattctaaaatttcttttactaaaatttatgaaataaat
atggaaatattaatgtcttcctgtttttccgaaccaaagtgtattcaagacattctagaa
attgacagaaaagtaagaatattagcaaaaaataaagtatcatctttaattttttaa

DBGET integrated database retrieval system