KEGG   Burkholderia sp. HB1: AC233_06205Help
Entry
AC233_06205       CDS       T04094                                 

Definition
(GenBank) amino acid transporter
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
buq  Burkholderia sp. HB1
Pathway
buq02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:buq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AC233_06205
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:buq02000]
    AC233_06205
Enzymes [BR:buq01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     AC233_06205
Transporters [BR:buq02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    AC233_06205
   Histidine transporter
    AC233_06205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 AAA_13 AAA_23 AAA_16 DUF87 G-alpha PRK AAA_33 FtsK_SpoIIIE APS_kinase AAA_28 AAA_22 RsgA_GTPase AAA_24 NACHT
Motif
Other DBs
NCBI-ProteinID: ALE54350
UniProt: A0A0M4NML1
Position
1:1446546..1447337
Genome map
AA seq 263 aa AA seqDB search
MLHTTQTQACKLAVQDIHKRYGDNEVLKGVSLNANKGDVISIIGASGSGKSTFLRCINFL
ERPNAGQIVVDGEAVKTKADRAGNLEVADHKQLQRIRTKLAMVFQHFNLWAHMNVIENVV
EAPIHVLGLPRREAEERAREYLEKVGLAPRVEKQYPAHLSGGQQQRVAIARALAMDPDVM
LFDEPTSALDPELVGEVLKVMQKLAEEGRTMIVVTHEMGFARNVSNHVMFLHQGRTEEEG
LPAEVLSAPRSERLKQFLSGSLK
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
ttgctccacaccacgcaaacccaggcttgcaagctcgccgtgcaggacatccacaagcgc
tacggcgacaacgaagtgctcaagggcgtgtcgctgaacgcgaacaagggcgacgtgatc
agcatcatcggcgcgagcggttcgggcaagagcaccttcctgcgctgcattaactttctc
gagcggccgaacgcggggcagattgtcgtcgacggcgaagcggtgaagaccaaggccgac
cgcgccggcaatctcgaagtcgcggatcacaagcagttgcaacgcattcgcacgaagctc
gcgatggtgttccagcacttcaatttgtgggcgcatatgaacgtgatcgagaacgtcgtc
gaggcgccgattcacgtgctcggcctgccgcgtcgcgaagccgaagagcgcgcgcgcgaa
tatctcgagaaggtgggcctcgcgccgcgcgtcgaaaaacagtatccggcgcatctgtcc
ggcggtcagcagcagcgcgtggcgattgcccgcgcgctcgcgatggatcccgatgtgatg
ctgttcgacgagccgacttcggcgctcgatcccgaactcgtcggcgaagtgttgaaggtc
atgcagaagctcgcggaagaagggcgcacgatgatcgtcgtcacccacgaaatgggtttt
gcgcgcaacgtgtcgaaccatgtgatgttcctgcatcaaggccgcacggaagaagaaggc
ttgcccgccgaagtgctgagcgcgccgcgcagcgagcggctcaagcagttcctctccggc
agcctgaagtaa

DBGET integrated database retrieval system