KEGG   Burkholderia sp. HB1: AC233_09265Help
Entry
AC233_09265       CDS       T04094                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00071  Fatty acid degradation
buq00072  Synthesis and degradation of ketone bodies
buq00280  Valine, leucine and isoleucine degradation
buq00310  Lysine degradation
buq00362  Benzoate degradation
buq00380  Tryptophan metabolism
buq00620  Pyruvate metabolism
buq00630  Glyoxylate and dicarboxylate metabolism
buq00640  Propanoate metabolism
buq00650  Butanoate metabolism
buq00900  Terpenoid backbone biosynthesis
buq01100  Metabolic pathways
buq01110  Biosynthesis of secondary metabolites
buq01120  Microbial metabolism in diverse environments
buq01130  Biosynthesis of antibiotics
buq01200  Carbon metabolism
buq01212  Fatty acid metabolism
buq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:buq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AC233_09265
   00630 Glyoxylate and dicarboxylate metabolism
    AC233_09265
   00640 Propanoate metabolism
    AC233_09265
   00650 Butanoate metabolism
    AC233_09265
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AC233_09265
   00072 Synthesis and degradation of ketone bodies
    AC233_09265
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AC233_09265
   00310 Lysine degradation
    AC233_09265
   00380 Tryptophan metabolism
    AC233_09265
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AC233_09265
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AC233_09265
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AC233_09265
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:buq04147]
    AC233_09265
Enzymes [BR:buq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AC233_09265
Exosome [BR:buq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AC233_09265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALE56571
UniProt: A0A0M3TWE1
Position
1:2153674..2154975
Genome map
AA seq 433 aa AA seqDB search
MPHPLPPVRRVAIIGGNRIPFARSNTAYATASNQDMLTFTLQGLIDRYNLHGERLGEVAA
GAVIKHSRDFNLTRESVLSTTLAKETPAYDVQQACGTGLETAILVANKIALGQIDVGIAG
GVDTTSDAPIGVNENLRKILLEANRGRSTGQRVGALAKLRPGMFFKPLLPRNGEPRTGLS
MGEHCELMAKRWNISREAQDVLAYDSHRKLAEAYARGFVNDLMTPYRGLARDNNLRSDLT
LEKLASLKPAFDRDAGTLTAGNSTPLTDGASAVLLASEDWAARRGLPVLAYLSWSETAAV
DYFDKKEGLLMAPAYAVPRMLARAGLTLQDFDFYEIHEAFAAQVLCTLAAWQDDEYCRTQ
LGLDGPLGAIDRAKLNVNGGSLATGHPFAATGGRIVAGLAKMLAQLDKPAGTARGLISIC
AAGGQGVVAILER
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacccgctgccacccgtgcgccgcgtcgcgattatcggcggcaaccggattccg
tttgcccgctcgaatacggcctacgcgaccgcgtcgaatcaggacatgctgaccttcacg
ctgcaaggactgatcgaccgctacaacctgcatggcgaacgtctcggcgaagtcgcggcg
ggcgccgtcatcaagcattcgcgcgacttcaatctcacgcgcgaatccgtgctgtccacc
acactcgcgaaggaaacacccgcgtacgatgtgcaacaggcgtgcggcacgggtctcgaa
accgcgatcctcgtggccaataaaattgcgttgggacagatcgacgtgggcatcgcaggc
ggcgtggatacgacctcggatgcgccgatcggcgtgaacgagaacctgcgcaagattctg
ctcgaggcgaaccgcggccgcagcacgggtcagcgtgtcggcgcgctggcgaagctgcgg
cccggcatgtttttcaagccgctgttgccgcgcaacggcgagccgcgcacgggtctttcg
atgggcgagcattgcgaactgatggcgaagcgctggaacatctcgcgcgaggcgcaggac
gtgctcgcctacgacagtcatcgcaagctcgccgaagcgtacgcgcgcggcttcgtcaac
gatctgatgacgccgtaccgcggccttgcgcgcgacaacaatctgcgctccgacctcacg
ctcgaaaagctcgcttcgctcaagcccgcgttcgatcgcgacgccggtacgctgaccgcc
ggcaattcgacgccgctcaccgacggcgcatcggcggtactgctcgcgagcgaggactgg
gccgcgcgccgcgggctgccggtgctggcgtatctgagctggtcggaaacggcggccgtc
gactacttcgacaagaaagagggcctcttgatggcgcctgcgtatgcggtgccgcgcatg
ctcgcacgcgcgggactgacgttgcaggacttcgatttctacgagatccacgaagcgttc
gccgcgcaagtgttgtgcacgctcgcggcatggcaggatgacgaatattgccgcacgcag
ttgggcctcgacggcccgctcggcgcgatcgatcgcgcgaagctcaacgtgaacggcggc
tcgctcgcgacgggtcatccgtttgcggcgacgggcgggcgcatcgtcgcgggtcttgcg
aagatgctcgcgcagctcgataagcccgcgggcaccgcgcgcggattgatctcgatctgc
gcggcgggcggccagggcgtggtggctattctggagcgctga

DBGET integrated database retrieval system