KEGG   Burkholderia sp. HB1: AC233_11110
Entry
AC233_11110       CDS       T04094                                 

Definition
(GenBank) aldolase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00626  Naphthalene degradation
buq01100  Metabolic pathways
buq01120  Microbial metabolism in diverse environments
buq01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:buq00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    AC233_11110
Enzymes [BR:buq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     AC233_11110
SSDB
Motif
Pfam: DHDPS RVT_N GDPD_2
Other DBs
NCBI-ProteinID: ALE55172
Position
1:complement(2577091..2578092)
AA seq 333 aa
MKRQKRLLTVEDIKGAWAIMPTPAKAGADDWRMADTVDLDETARVAEELVKAGVDGIISL
GTFGECAALTWDEKRAFISTVVETVRGRIPFFCGTSSLNTRETIRQTREAFDIGADGTML
GLPMWQICDVKSAVQFFSDVAEAVPEMAIAVYANPEAFKFDFPRSFWAGVSEIPQVVTAK
YMGIGALHLDMMLTKRRIRFLPIDMDYVAAARIDPDFITGFWTSGTNLGPAPAIHLRDEV
LKAKKTGDWSKAQELQNAILATAQTLFPNGSFKEFSTYNVQLEKARFNAGGWMNAGPARP
PYRFDSVPEAYLEGARISGRKWAELHEKLSQNR
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgaagcgtcaaaaaagactactcaccgttgaagacatcaagggcgcttgggcgatcatg
ccgacgcccgctaaagcaggagccgacgattggcggatggcagacacggttgatctggac
gagaccgcgcgcgttgccgaagagttggtgaaggccggtgtagatggaattatttcactg
ggtacgtttggcgagtgcgcggccctcacctgggacgagaagcgagctttcatatcgact
gtggtcgaaacggttcgtggtcggatcccctttttttgcggtacaagcagcctgaacacg
cgcgaaaccatccggcaaaccagagaggcgtttgatatcggcgcagatggaacgatgttg
ggcctgccaatgtggcagatttgcgacgtgaaatcggctgtgcaattttttagcgatgtt
gcggaagctgtgccggaaatggccattgcggtttatgcgaatccagaggcgttcaaattc
gactttccccgctccttttgggctggagtatcggagattcctcaggtcgtgaccgccaaa
tacatgggcattggcgcgctgcacctcgacatgatgctgacaaagcgccgtattcgcttt
ttgccgatcgacatggattatgtggccgctgcgcggattgatccggactttatcactgga
ttctggaccagcggaacgaatttagggcctgcgccggcgattcatttgagagatgaagtg
ttaaaggcgaaaaagaccggagactggtcgaaagcccaggaactgcagaacgcgattctt
gctactgcccaaactttgttccccaatggatcttttaaggaattttcgacttacaacgtc
cagcttgaaaaggcacgattcaatgctggtggctggatgaatgcaggtcccgcccggccg
ccctatcgcttcgattctgttcctgaagcctatctcgaaggggcgcgtatatccggaagg
aagtgggcagaacttcacgagaagttaagtcagaataggtaa

DBGET integrated database retrieval system