KEGG   Burkholderia sp. HB1: AC233_16650Help
Entry
AC233_16650       CDS       T04094                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
buq  Burkholderia sp. HB1
Pathway
buq03010  Ribosome
Brite
KEGG Orthology (KO) [BR:buq00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AC233_16650
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:buq03011]
    AC233_16650
Ribosome [BR:buq03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AC233_16650
  Bacteria
    AC233_16650
  Archaea
    AC233_16650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ALE56121
UniProt: A0A0M3TW50
Position
1:complement(3775769..3776098)
Genome map
AA seq 109 aa AA seqDB search
MEVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAGIVKKVVLSAIANAEH
NEGADIDELKITSIYIDKAASLKRFTARAKGRGNRIEKQSCHITVTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaaagcaattcatcgcggtgcccgcatctcggcgcagaaaacgcgccttgtg
gctgaccagatccgcggtttgccggtcgacaaggcgctgaacgttctgacgttctcgccg
aagaaggctgcgggaatcgtgaaaaaggtcgtgctgtcggcgatcgcgaatgcggagcat
aacgaaggcgccgatatcgatgagctcaagatcacgagcatctacatcgacaaggctgcg
tcgctcaagcgtttcaccgcgcgcgctaaaggccgcggtaaccgcatcgagaagcaatcc
tgtcacatcactgtgacggtcgggaattaa

DBGET integrated database retrieval system