KEGG   Burkholderia sp. HB1: AC233_30000Help
Entry
AC233_30000       CDS       T04094                                 

Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
buq  Burkholderia sp. HB1
Brite
KEGG Orthology (KO) [BR:buq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AC233_30000
Enzymes [BR:buq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     AC233_30000
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     AC233_30000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-ProteinID: ALE58734
UniProt: A0A0M4PKF2
Position
2:2225018..2226019
Genome map
AA seq 333 aa AA seqDB search
MSNYLPVIGITMGDAAGVGPEIVVKSLAHDIVYKQCRPLVIGDARRLERATQIVGGTAKI
RRIKEAAEARYEPGTIDCIDLDLIPDDLPFGQLSAVAGDAAYRFIARAVELAEAKQIDAI
CTAPLNKEALHAGGHKFPGHTEMLAYLTGVDEVSMMLVAPQLRVIHVTTHIGIIDAIRKI
EPGLVQRTIERGNATLVKAGIAKPRIGVCGINPHAGENGLFGYGEEEEKIVPAVKVLQER
GLDVTGPLPADTLFFRAGRGDFDLVVAMYHDQGHGPVKVLGLEAGVNVTVGLEVIRTSVD
HGTAFDIAGKGIADERSLLEALRQGAELATRRG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagcaactaccttcccgtaatcggcatcacaatgggcgacgcagcgggcgtcggcccg
gagatcgtcgtcaagagccttgcgcacgacatcgtttacaagcagtgccgtccgctcgtg
atcggcgatgcgcgccggctcgaacgcgcgactcagatcgttggcggcacagcgaagatc
cgccgtatcaaggaggcggccgaagcgcgctatgagccgggcacgattgactgcatcgac
ctcgatctgattcccgacgatctgccgttcggccagttgtcggcagtcgcgggcgacgcc
gcctaccggttcatcgcgcgcgcggttgaactcgcggaggcgaagcagatcgacgcgatc
tgcacggcgccgttaaacaaggaagcgctgcacgcgggcggccacaagtttcccggccac
actgaaatgcttgcgtacctgacgggcgtcgatgaagtgtcgatgatgctggtagcgccg
caactgcgcgtgatccacgtgacgacgcacatcggcatcatcgacgcgatccgcaagatc
gagccgggcctcgtgcaacgcacgatcgagcgcggcaacgcgacactggtcaaggccggc
attgcaaagccgcgtatcggtgtgtgcggcatcaatccacacgcgggcgagaacggcctg
ttcggttacggcgaggaagaagagaagattgttccggcagtgaaagtgttgcaggagcgc
ggcctggacgtgaccggcccgctacccgcggatacgctgttcttccgcgcgggccggggc
gacttcgatctcgtcgtcgcgatgtatcacgaccagggacatggcccggtgaaggtgctg
ggtctcgaagccggcgtgaacgtgacggtgggtctcgaagtcatccgtacctcggtcgat
catggcaccgcattcgacatcgcgggcaagggcattgccgacgagcgcagcctgctcgaa
gcactgcgccagggcgcggaactcgcgacgcggcgcggctga

DBGET integrated database retrieval system