KEGG   Burkholderia sp. HB1: AC233_30340Help
Entry
AC233_30340       CDS       T04094                                 

Definition
(GenBank) epimerase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00053  Ascorbate and aldarate metabolism
buq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    AC233_30340
Enzymes [BR:buq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     AC233_30340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_10 NAD_binding_4 Polysacc_synt_2 NmrA RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: ALE58796
UniProt: A0A0M4NS83
Position
2:2296703..2297560
Genome map
AA seq 285 aa AA seqDB search
MKKIALSGAGGQLGSVVRAAFIARGTPLRSAAGSKPLTPLIDGEDVMHGDLRDPAVVDRL
LEGVDVLIHFAGTSVERPLPEIIENNLRGLVEVYEGARRHGVKRIVFASSNHAIGMYPVT
ERLSLDCELRPDGFYGLSKVWGEALARMYWDKHGIESVCVRIGSCLERPTEPRHLSTWFG
HADLMHFLDRCIEADDLGFITVWGVSANTRSWWDNSGAARLGYTPKQNAEDYADEILARP
NPLDALGQRFQGGGFVGIDYSRREEEGAGTGAGTGAGSASAARPA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagattgcccttagtggcgccggtggccagcttggctcggtcgtgcgcgccgcg
ttcattgcgcgcggcacgccgctgcgttcggcggccggctcgaagccgctcacgccgctc
atcgacggcgaggatgtgatgcatggcgacctgcgcgatcctgcggtcgtcgaccggctg
ctggaaggcgtcgacgtgctgatccacttcgccggcacgagtgtcgagcgtccgctgccc
gagatcatcgaaaacaatttgcgcggtctcgtcgaggtgtacgagggcgcgcggcggcac
ggcgtgaagcgcatcgtattcgccagctcgaatcacgcgatcggcatgtatccggtgacg
gagcggctgagcctcgattgcgaactgcgtcccgacggcttctatggcctgagcaaggtc
tggggcgaagcgctcgcccgcatgtactgggacaagcacggcatcgagagcgtgtgtgtg
cgcatcggcagttgcctcgagcgtccgaccgagccgcgccatctcagcacctggttcggc
cacgcggacctgatgcatttcctcgaccgctgcatcgaagccgacgatctcggcttcatc
accgtgtggggcgtgtcggccaatacgcgtagctggtgggacaacagcggcgcagcgcgc
ctcggctacacgccgaagcagaacgccgaagactacgccgacgaaatcctggcccgtccg
aatccgctcgatgcgctgggccagcgcttccagggcggcggctttgtcggcatcgattat
tcgcggcgtgaggaagagggcgccggcacgggcgcgggcaccggcgcgggcagcgcttcg
gcggcgcggccggcctga

DBGET integrated database retrieval system