KEGG   Burkholderia sp. HB1: AC233_30370Help
Entry
AC233_30370       CDS       T04094                                 

Definition
(GenBank) 2,5-dioxovalerate dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00040  Pentose and glucuronate interconversions
buq00053  Ascorbate and aldarate metabolism
buq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AC233_30370
   00053 Ascorbate and aldarate metabolism
    AC233_30370
Enzymes [BR:buq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     AC233_30370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALE58802
Position
2:2305381..2306988
Genome map
AA seq 535 aa AA seqDB search
MSHSSEVTGQITGEMLIGRKAVRGAEQALHAFNPTTGTDIAEPVFGSGTASDVNLACELA
GKAFDPYRQLPLSVRAEFLERIADGITALGDALVERAQQESGLPKARLEGERGRTTGQLK
LFAQVVRSGQWLTATLDSPLPDRKPLPRSDLRMQRIPVGPVAVFGASNFPLAFSVAGGDT
AAALAAGCPVVVKAHRAHLGTSEMVGRVIQRVAAEMDLPEGVFSLIVGAGNSVGEALVAH
PAIKAVGFTGSRAGGLSLMRVAAARPEPIPVYAEMSSINPVFLLSNALKQRTENIARGFV
DSLALGAGQFCTNPGLAIAVDSDALKSFVATASEALAAKPAQTMLTSGIHSAYTEGEGKL
AKTAGVETVARGADVTGPNQARAALFVTDAQTFVATPALEDEVFGPASTIVRCKDEAELL
QVAEHFAGQLTATIQMDAADVPAAQKLVPILERKAGRLLVNGFPTGVEVCHAMVHGGPFP
ATSDSRATSVGTTAIERFLRPVCYQDFPADLLPEALADSNPLNLWRRRDGEITRS
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtcccattccagcgaagtcaccggccagatcaccggcgaaatgctgatcggccgcaag
gccgtgcgcggcgccgaacaggcgctgcacgcgttcaatcccaccaccggcacggacatc
gccgagccggttttcggcagcggcacggctagcgacgtcaacctcgcctgcgaactggcg
ggcaaggcattcgatccgtaccgccaactgccgctcagcgtgcgcgccgagttcctcgaa
cgtatcgcggacggcatcacggcgttgggcgatgcgctcgtcgagcgcgcgcagcaggaa
tccggcttgccgaaggcgcgtctggaaggcgagcgcggccgcacgaccggccagctcaag
ctgtttgcgcaagtagtgcgctcgggccagtggcttaccgcgacgctcgattcgccgctg
ccggaccgcaagccgctgccgcgttccgatctgcgcatgcaaaggattccggtgggaccg
gtcgccgtgttcggcgccagcaatttcccgctcgcgttctcggtggccggcggcgacacg
gcggcggcgctcgcagccggttgcccggttgtcgtgaaggcgcatcgcgcgcacctcggc
acgtcggagatggtcggccgtgtgatccagcgcgtcgcagcggaaatggacctgccggaa
ggcgtgttctcgctgatcgtcggcgcaggcaattcggtcggcgaggcgctcgtcgcgcat
ccggcgatcaaggcggtcggcttcaccggttcgcgcgcgggcggcttgtcgctgatgcgc
gtcgcggcggcgcgccccgagccgattccggtctacgcggaaatgagcagcatcaacccg
gtgtttctgctgtcgaacgcgctcaagcagcgcaccgagaacatcgcgcgcggcttcgtc
gattcgctcgcgctgggcgccggccagttctgcacgaacccgggcctcgcgattgccgtc
gacagcgatgcgctgaagagtttcgtcgccaccgcctctgaagccctggccgccaagccg
gcgcagaccatgctgacttcgggcatccactccgcctacacggaaggcgagggcaagctg
gccaagaccgccggcgtcgaaacggtggcgcgcggcgccgacgtaacgggcccgaaccag
gcgcgcgccgcactgttcgtgaccgacgcgcagacgttcgtcgccacgccggcgctggag
gacgaggtattcggtccggcatcgacgatcgtgcgctgcaaggatgaagccgagctgttg
caagttgccgagcactttgccggccaactgacggccacgatccagatggacgccgccgac
gtgcccgcggcccagaagctcgtgccgattctcgagcgcaaggccgggcgtctgctggtc
aacggctttccgaccggcgtcgaagtctgccacgcgatggtccacggcggcccgttcccg
gcgacctccgacagccgcgcgacctcggtcgggacgaccgcgatcgaacgcttcctgcgc
ccggtctgctatcaggacttcccggcggatctgttgccggaggcgctggctgacagcaat
ccgctgaatctgtggcgtcgccgcgatggcgagatcacgcgcagctaa

DBGET integrated database retrieval system