KEGG   Burkholderia sp. HB1: AC233_30395Help
Entry
AC233_30395       CDS       T04094                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00053  Ascorbate and aldarate metabolism
buq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    AC233_30395
Enzymes [BR:buq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     AC233_30395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_10 NAD_binding_4 Polysacc_synt_2 RmlD_sub_bind NmrA
Motif
Other DBs
NCBI-ProteinID: ALE58807
UniProt: A0A0M4P4R3
Position
2:2312390..2313232
Genome map
AA seq 280 aa AA seqDB search
MTDSNSDHPSSKKPFRRLLLTGAAGNLGKQLRGALAAWADVVRVTDIAPLGELAAHEEAS
IVDLADEAAVLALLEGVDAVIHLGGISVEAPFADLLEANIRGLYNLYSAAQKQGVKRVVY
ASSNHAVGFHPVTEVLDTDAPLRPDSLYGVTKCFGESLSRYYFDRFGLETVCLRIGSSFE
QPKNPRMLVTYLSYRDFIELVRCSLFTNRVGHAIVYGVSDNRTKWVDNTKAAFLGFRPQD
SSVQFEHLFPVTAPTADLDDPTQRFQGGPFVLAGPMEPKR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgactgattcgaattccgaccacccatcctcgaaaaaaccgtttcgacgcctgctgctc
accggcgcggcaggcaatctcggcaagcaattgcgcggcgcgctggccgcgtgggccgac
gtggtgcgcgtgaccgacatcgcgccgctcggcgagctggctgcgcacgaagaagcgtcg
atcgtcgacctcgccgacgaagccgcggtcctcgcgctgctcgaaggcgtggacgcggtg
attcacctcggcggcatctccgtcgaagcgccgttcgccgatctgctcgaagcgaacatt
cgtggtctctacaacctgtattcggcggcgcagaagcagggcgtgaagcgcgtcgtctac
gcaagctcgaatcacgcggtcggttttcatccggtgacggaagtgctcgataccgacgcg
ccgttgcgtccggacagcctgtatggcgtgaccaaatgcttcggcgaatcgctgtcgcgc
tattacttcgaccgcttcgggctcgagacggtgtgtctgcggatcggctcgtcgttcgag
cagccgaagaacccgcgcatgctcgtcacgtatctgagctatcgcgacttcatcgaactc
gtgcgctgttcgctgttcacgaatcgcgtcgggcacgcgatcgtgtacggcgtgtcggat
aaccgcaccaagtgggtcgataacaccaaagcggcgtttctcggtttccgtccgcaggac
agctccgttcagttcgagcatctgttcccggtcaccgcgccgactgccgatctggacgat
cccacgcagcgctttcagggcgggccgttcgtgctggccgggccgatggagccgaagcga
tga

DBGET integrated database retrieval system